Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A5B0MYT5

Protein Details
Accession A0A5B0MYT5    Localization Confidence Low Confidence Score 8
NoLS Segment(s)
PositionSequenceProtein Nature
91-115AVHPPTQPQKKPPRRSPSPIDPSHRHydrophilic
NLS Segment(s)
PositionSequence
100-125KKPPRRSPSPIDPSHRSGRKGTNKKG
Subcellular Location(s) extr 17, cyto 4.5, cyto_nucl 3.5, mito 3
Family & Domain DBs
Amino Acid Sequences MPTAINSLASIFLSFLYLVSHMAHELRATGPRFPWPQNPRIHGPGGGGPGPPGPPSPGNCTGIVFRPKIGPLNQSTQNDHGGATDHPNLHAVHPPTQPQKKPPRRSPSPIDPSHRSGRKGTNKKGSSIGAL
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.08
2 0.07
3 0.07
4 0.07
5 0.08
6 0.08
7 0.09
8 0.08
9 0.09
10 0.09
11 0.08
12 0.09
13 0.1
14 0.15
15 0.16
16 0.17
17 0.18
18 0.25
19 0.29
20 0.31
21 0.39
22 0.39
23 0.46
24 0.51
25 0.55
26 0.53
27 0.53
28 0.51
29 0.42
30 0.37
31 0.33
32 0.28
33 0.24
34 0.18
35 0.15
36 0.14
37 0.14
38 0.12
39 0.1
40 0.1
41 0.11
42 0.14
43 0.2
44 0.23
45 0.25
46 0.25
47 0.25
48 0.24
49 0.26
50 0.28
51 0.21
52 0.18
53 0.17
54 0.17
55 0.19
56 0.2
57 0.18
58 0.18
59 0.23
60 0.28
61 0.29
62 0.31
63 0.3
64 0.3
65 0.27
66 0.24
67 0.19
68 0.14
69 0.13
70 0.14
71 0.16
72 0.14
73 0.14
74 0.16
75 0.16
76 0.16
77 0.21
78 0.2
79 0.22
80 0.24
81 0.3
82 0.37
83 0.44
84 0.47
85 0.51
86 0.6
87 0.65
88 0.73
89 0.78
90 0.79
91 0.8
92 0.85
93 0.85
94 0.84
95 0.83
96 0.81
97 0.78
98 0.73
99 0.71
100 0.73
101 0.69
102 0.61
103 0.57
104 0.6
105 0.63
106 0.68
107 0.72
108 0.73
109 0.7
110 0.7
111 0.7