Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A5B0RE15

Protein Details
Accession A0A5B0RE15    Localization Confidence Low Confidence Score 7.6
NoLS Segment(s)
PositionSequenceProtein Nature
8-33IPNALHQKKVKVRVHNRLKQHEKKSFHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 17, nucl 9, cyto_mito 9
Family & Domain DBs
Amino Acid Sequences MNLGSSNIPNALHQKKVKVRVHNRLKQHEKKSFAPIRTLGLRGYYYPEDRCRVGGASAVEAKSSPVPANQNVKGFD
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.4
2 0.46
3 0.56
4 0.6
5 0.63
6 0.69
7 0.72
8 0.81
9 0.79
10 0.8
11 0.8
12 0.84
13 0.82
14 0.82
15 0.79
16 0.73
17 0.7
18 0.71
19 0.67
20 0.58
21 0.52
22 0.44
23 0.4
24 0.36
25 0.33
26 0.23
27 0.18
28 0.17
29 0.14
30 0.17
31 0.16
32 0.17
33 0.19
34 0.23
35 0.24
36 0.24
37 0.24
38 0.22
39 0.2
40 0.18
41 0.19
42 0.16
43 0.17
44 0.19
45 0.18
46 0.17
47 0.16
48 0.17
49 0.15
50 0.16
51 0.13
52 0.15
53 0.2
54 0.26
55 0.35
56 0.38