Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A5B0QF13

Protein Details
Accession A0A5B0QF13    Localization Confidence Low Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
11-32LSTLQRQLRKSARRNRLRTTVNHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 24, cyto 2
Family & Domain DBs
Amino Acid Sequences MILLWNSLENLSTLQRQLRKSARRNRLRTTVNGAKSKFVEDTIQMQIYEKIGMGQTKPDVMDPAVPIKVLQFKQGQKTPYSKRD
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.2
2 0.26
3 0.27
4 0.35
5 0.42
6 0.49
7 0.57
8 0.65
9 0.7
10 0.75
11 0.81
12 0.8
13 0.8
14 0.74
15 0.69
16 0.67
17 0.65
18 0.61
19 0.6
20 0.53
21 0.46
22 0.42
23 0.4
24 0.31
25 0.23
26 0.18
27 0.13
28 0.16
29 0.16
30 0.16
31 0.14
32 0.14
33 0.14
34 0.13
35 0.12
36 0.08
37 0.07
38 0.07
39 0.08
40 0.08
41 0.1
42 0.1
43 0.11
44 0.12
45 0.11
46 0.12
47 0.11
48 0.14
49 0.13
50 0.16
51 0.15
52 0.15
53 0.14
54 0.15
55 0.22
56 0.2
57 0.24
58 0.28
59 0.33
60 0.42
61 0.47
62 0.48
63 0.46
64 0.55