Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A5B0LI10

Protein Details
Accession A0A5B0LI10    Localization Confidence Medium Confidence Score 11.9
NoLS Segment(s)
PositionSequenceProtein Nature
1-23MPSKIPIVKKRTKPFIRHQSDRYHydrophilic
26-46VKQAWRKPKGIDNRVRRRFKGBasic
NLS Segment(s)
PositionSequence
28-45QAWRKPKGIDNRVRRRFK
Subcellular Location(s) mito 14.5, mito_nucl 11.5, nucl 7.5, cyto 5
Family & Domain DBs
InterPro View protein in InterPro  
IPR001515  Ribosomal_L32e  
IPR036351  Ribosomal_L32e_sf  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF01655  Ribosomal_L32e  
CDD cd00513  Ribosomal_L32_L32e  
Amino Acid Sequences MPSKIPIVKKRTKPFIRHQSDRYASVKQAWRKPKGIDNRVRRRFKGQLPMPSIGYGSNKKTRHLMPNGYKKFVVNNPGEVDLLLMHNTTFAAEIAHNVSARKRIEIIEKARILGVKVTNAAAKLRSEE
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.84
2 0.86
3 0.86
4 0.84
5 0.78
6 0.78
7 0.73
8 0.69
9 0.62
10 0.54
11 0.46
12 0.45
13 0.48
14 0.45
15 0.5
16 0.54
17 0.57
18 0.58
19 0.6
20 0.61
21 0.64
22 0.67
23 0.68
24 0.7
25 0.75
26 0.8
27 0.83
28 0.77
29 0.73
30 0.71
31 0.67
32 0.67
33 0.62
34 0.61
35 0.6
36 0.59
37 0.53
38 0.45
39 0.39
40 0.29
41 0.26
42 0.2
43 0.19
44 0.25
45 0.25
46 0.26
47 0.3
48 0.33
49 0.37
50 0.39
51 0.44
52 0.45
53 0.55
54 0.57
55 0.55
56 0.51
57 0.43
58 0.42
59 0.36
60 0.34
61 0.25
62 0.25
63 0.24
64 0.25
65 0.25
66 0.21
67 0.18
68 0.11
69 0.1
70 0.08
71 0.06
72 0.05
73 0.05
74 0.05
75 0.05
76 0.05
77 0.04
78 0.05
79 0.05
80 0.07
81 0.08
82 0.1
83 0.11
84 0.11
85 0.13
86 0.18
87 0.19
88 0.2
89 0.19
90 0.2
91 0.28
92 0.36
93 0.4
94 0.43
95 0.43
96 0.42
97 0.42
98 0.4
99 0.33
100 0.3
101 0.27
102 0.2
103 0.21
104 0.22
105 0.22
106 0.22
107 0.23
108 0.2