Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A5B0MAA3

Protein Details
Accession A0A5B0MAA3    Localization Confidence Medium Confidence Score 11.8
NoLS Segment(s)
PositionSequenceProtein Nature
24-45VAKQERTKKKLQGRAKKRCLYNHydrophilic
NLS Segment(s)
PositionSequence
25-41AKQERTKKKLQGRAKKR
Subcellular Location(s) nucl 13, mito 9.5, cyto_mito 7.5, cyto 4.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR006846  Ribosomal_S30  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF04758  Ribosomal_S30  
Amino Acid Sequences MNLRFPVHGSLARAGKVRSQCPKVAKQERTKKKLQGRAKKRCLYNNRFAITTPQGGRRKMNPAPAGKMG
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.28
2 0.3
3 0.32
4 0.36
5 0.39
6 0.41
7 0.44
8 0.48
9 0.56
10 0.6
11 0.65
12 0.66
13 0.68
14 0.75
15 0.79
16 0.79
17 0.77
18 0.75
19 0.74
20 0.75
21 0.74
22 0.74
23 0.75
24 0.8
25 0.84
26 0.82
27 0.79
28 0.79
29 0.79
30 0.77
31 0.76
32 0.73
33 0.65
34 0.59
35 0.54
36 0.51
37 0.44
38 0.42
39 0.35
40 0.36
41 0.39
42 0.42
43 0.45
44 0.44
45 0.49
46 0.48
47 0.55
48 0.53
49 0.53