Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

H1VK21

Protein Details
Accession H1VK21    Localization Confidence Medium Confidence Score 12.3
NoLS Segment(s)
PositionSequenceProtein Nature
37-69CRKCYARLPPRATNCRKRKCGHTNQLRPKKKLKHydrophilic
NLS Segment(s)
PositionSequence
63-69RPKKKLK
Subcellular Location(s) nucl 14.5, mito 11, cyto_nucl 8
Family & Domain DBs
InterPro View protein in InterPro  
IPR038587  L40e_sf  
IPR001975  Ribosomal_L40e  
IPR011332  Ribosomal_zn-bd  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF01020  Ribosomal_L40e  
Amino Acid Sequences MKDCESTLHLVLRLRGGIIEPSLKALASKFNCDKMICRKCYARLPPRATNCRKRKCGHTNQLRPKKKLK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.18
2 0.16
3 0.14
4 0.13
5 0.12
6 0.12
7 0.1
8 0.12
9 0.12
10 0.12
11 0.11
12 0.1
13 0.16
14 0.16
15 0.22
16 0.22
17 0.25
18 0.27
19 0.27
20 0.31
21 0.34
22 0.4
23 0.37
24 0.39
25 0.38
26 0.41
27 0.49
28 0.55
29 0.54
30 0.55
31 0.6
32 0.65
33 0.72
34 0.77
35 0.78
36 0.79
37 0.8
38 0.8
39 0.81
40 0.78
41 0.8
42 0.8
43 0.83
44 0.83
45 0.84
46 0.85
47 0.88
48 0.94
49 0.93