Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A5B0PQM8

Protein Details
Accession A0A5B0PQM8    Localization Confidence Medium Confidence Score 10.2
NoLS Segment(s)
PositionSequenceProtein Nature
177-203AKYQLKLLKGKKLTRRERRQVSGSKAIHydrophilic
NLS Segment(s)
PositionSequence
184-195LKGKKLTRRERR
Subcellular Location(s) mito 19, nucl 6.5, cyto_nucl 4.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR044202  LETM1/MDM38-like  
Gene Ontology GO:0005743  C:mitochondrial inner membrane  
Amino Acid Sequences MTGVWLRNSSIVSTRNQPARMIQRGEEIHSAEDSFLRSFQGKWRLTNYSASTLGIARSSVLTAAYPHQHSRAFSQLSPLGFPSNHWPSTSPLILRDRLAYPRSYNSLIKRFNSTGPTPPSDNEKELTQSHKSSSKTLTPATDQQLTRLQRIWKSVREEASHYWHGTKLLGKEIRLSAKYQLKLLKGKKLTRRERRQVSGSKAI
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.36
2 0.41
3 0.41
4 0.41
5 0.43
6 0.49
7 0.53
8 0.5
9 0.44
10 0.46
11 0.46
12 0.48
13 0.43
14 0.36
15 0.29
16 0.26
17 0.25
18 0.18
19 0.17
20 0.15
21 0.12
22 0.11
23 0.12
24 0.12
25 0.13
26 0.2
27 0.29
28 0.29
29 0.32
30 0.37
31 0.4
32 0.41
33 0.47
34 0.43
35 0.38
36 0.36
37 0.33
38 0.28
39 0.24
40 0.22
41 0.16
42 0.13
43 0.08
44 0.07
45 0.07
46 0.06
47 0.06
48 0.06
49 0.07
50 0.09
51 0.13
52 0.14
53 0.15
54 0.18
55 0.2
56 0.2
57 0.23
58 0.27
59 0.26
60 0.24
61 0.27
62 0.27
63 0.26
64 0.25
65 0.23
66 0.17
67 0.15
68 0.16
69 0.18
70 0.2
71 0.21
72 0.2
73 0.21
74 0.22
75 0.26
76 0.27
77 0.2
78 0.19
79 0.22
80 0.23
81 0.22
82 0.21
83 0.19
84 0.21
85 0.22
86 0.19
87 0.17
88 0.19
89 0.21
90 0.22
91 0.24
92 0.25
93 0.31
94 0.33
95 0.33
96 0.35
97 0.34
98 0.33
99 0.34
100 0.31
101 0.3
102 0.31
103 0.32
104 0.29
105 0.28
106 0.32
107 0.3
108 0.3
109 0.24
110 0.21
111 0.22
112 0.23
113 0.27
114 0.24
115 0.22
116 0.24
117 0.28
118 0.28
119 0.28
120 0.31
121 0.31
122 0.31
123 0.32
124 0.32
125 0.3
126 0.34
127 0.35
128 0.38
129 0.32
130 0.32
131 0.37
132 0.37
133 0.35
134 0.35
135 0.35
136 0.31
137 0.39
138 0.41
139 0.4
140 0.45
141 0.48
142 0.49
143 0.48
144 0.49
145 0.46
146 0.48
147 0.45
148 0.4
149 0.36
150 0.32
151 0.3
152 0.27
153 0.27
154 0.22
155 0.27
156 0.29
157 0.28
158 0.31
159 0.35
160 0.4
161 0.37
162 0.37
163 0.36
164 0.41
165 0.42
166 0.43
167 0.43
168 0.42
169 0.51
170 0.54
171 0.56
172 0.56
173 0.63
174 0.68
175 0.73
176 0.79
177 0.81
178 0.86
179 0.87
180 0.89
181 0.89
182 0.88
183 0.87