Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A5B0P654

Protein Details
Accession A0A5B0P654    Localization Confidence High Confidence Score 17.2
NoLS Segment(s)
PositionSequenceProtein Nature
6-26PKIRNLLKSFARKRRRAADREBasic
45-64WSRRRFKKCHLYPTIRQEKRBasic
NLS Segment(s)
PositionSequence
13-21KSFARKRRR
Subcellular Location(s) nucl 18, cyto 7
Family & Domain DBs
Amino Acid Sequences MEAERPKIRNLLKSFARKRRRAADRESEVALEIDTSAYAGTPVIWSRRRFKKCHLYPTIRQEKRRNPRPPTQDELQQAKDKASGFRKFTHGKVILRDTTNGGEVIAVIEFTPLDELSPEEKNEINFVTTYLHQM
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.7
2 0.73
3 0.79
4 0.76
5 0.79
6 0.81
7 0.82
8 0.78
9 0.78
10 0.78
11 0.74
12 0.71
13 0.64
14 0.54
15 0.44
16 0.37
17 0.28
18 0.17
19 0.11
20 0.07
21 0.05
22 0.05
23 0.04
24 0.03
25 0.04
26 0.03
27 0.03
28 0.04
29 0.06
30 0.12
31 0.18
32 0.21
33 0.3
34 0.4
35 0.46
36 0.49
37 0.57
38 0.63
39 0.65
40 0.73
41 0.73
42 0.71
43 0.71
44 0.78
45 0.8
46 0.73
47 0.73
48 0.71
49 0.71
50 0.74
51 0.78
52 0.76
53 0.72
54 0.76
55 0.77
56 0.75
57 0.71
58 0.63
59 0.59
60 0.55
61 0.54
62 0.48
63 0.44
64 0.38
65 0.32
66 0.32
67 0.26
68 0.26
69 0.29
70 0.31
71 0.31
72 0.33
73 0.39
74 0.4
75 0.4
76 0.44
77 0.42
78 0.38
79 0.41
80 0.44
81 0.42
82 0.4
83 0.4
84 0.33
85 0.29
86 0.27
87 0.22
88 0.16
89 0.11
90 0.1
91 0.09
92 0.07
93 0.05
94 0.04
95 0.04
96 0.04
97 0.04
98 0.06
99 0.05
100 0.05
101 0.06
102 0.08
103 0.11
104 0.14
105 0.15
106 0.15
107 0.17
108 0.18
109 0.2
110 0.19
111 0.18
112 0.15
113 0.15
114 0.17