Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A5B0LY78

Protein Details
Accession A0A5B0LY78    Localization Confidence Medium Confidence Score 14.3
NoLS Segment(s)
PositionSequenceProtein Nature
51-72NETQNGRKKRRRSSYVDKKALNHydrophilic
NLS Segment(s)
PositionSequence
57-62RKKRRR
Subcellular Location(s) nucl 23.5, cyto_nucl 14
Family & Domain DBs
Amino Acid Sequences MTILRINQVKSHQMRPKVTRFFVAKFSRDQRDANHISGPPILQDANPPSENETQNGRKKRRRSSYVDKKALNRYWPTHPAVVRPLNPAASPVRHPRALTLILHEGPPSRLRLGTPPRPHEQGRLGNPDENDSINQIQDDDDLNNRSRDDSQDEDEESRPRSRRRLG
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.64
2 0.67
3 0.73
4 0.72
5 0.69
6 0.67
7 0.63
8 0.58
9 0.59
10 0.57
11 0.5
12 0.49
13 0.54
14 0.53
15 0.52
16 0.51
17 0.45
18 0.49
19 0.5
20 0.44
21 0.42
22 0.35
23 0.33
24 0.33
25 0.29
26 0.19
27 0.17
28 0.15
29 0.1
30 0.14
31 0.15
32 0.19
33 0.19
34 0.19
35 0.22
36 0.27
37 0.28
38 0.26
39 0.3
40 0.33
41 0.41
42 0.5
43 0.54
44 0.56
45 0.64
46 0.72
47 0.76
48 0.75
49 0.76
50 0.79
51 0.81
52 0.85
53 0.84
54 0.77
55 0.72
56 0.73
57 0.67
58 0.6
59 0.53
60 0.46
61 0.44
62 0.45
63 0.43
64 0.38
65 0.35
66 0.32
67 0.34
68 0.34
69 0.3
70 0.27
71 0.25
72 0.22
73 0.21
74 0.21
75 0.17
76 0.15
77 0.17
78 0.21
79 0.24
80 0.24
81 0.25
82 0.24
83 0.26
84 0.26
85 0.23
86 0.21
87 0.2
88 0.19
89 0.2
90 0.19
91 0.16
92 0.15
93 0.16
94 0.15
95 0.12
96 0.12
97 0.13
98 0.21
99 0.29
100 0.37
101 0.43
102 0.47
103 0.51
104 0.55
105 0.56
106 0.52
107 0.52
108 0.5
109 0.49
110 0.51
111 0.49
112 0.47
113 0.46
114 0.44
115 0.37
116 0.3
117 0.25
118 0.21
119 0.19
120 0.16
121 0.16
122 0.13
123 0.12
124 0.12
125 0.13
126 0.11
127 0.14
128 0.17
129 0.19
130 0.2
131 0.2
132 0.22
133 0.22
134 0.24
135 0.27
136 0.28
137 0.31
138 0.33
139 0.36
140 0.37
141 0.38
142 0.37
143 0.35
144 0.37
145 0.4
146 0.42