Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A5B0LZA7

Protein Details
Accession A0A5B0LZA7    Localization Confidence Medium Confidence Score 14.4
NoLS Segment(s)
PositionSequenceProtein Nature
22-41SLPGQSKEPSRKKRNPGPVLHydrophilic
NLS Segment(s)
PositionSequence
31-35SRKKR
Subcellular Location(s) nucl 25, cyto_nucl 14
Family & Domain DBs
Amino Acid Sequences MGKQRKRHKETESPRSSGSSSSLPGQSKEPSRKKRNPGPVLIDDDSEVEPSPSVDATTPGSLSKPSKAILTDEQELSKHLSHCL
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.68
2 0.63
3 0.54
4 0.44
5 0.37
6 0.29
7 0.23
8 0.22
9 0.25
10 0.23
11 0.24
12 0.25
13 0.26
14 0.31
15 0.4
16 0.47
17 0.52
18 0.61
19 0.69
20 0.75
21 0.8
22 0.83
23 0.79
24 0.75
25 0.71
26 0.65
27 0.63
28 0.54
29 0.45
30 0.34
31 0.29
32 0.23
33 0.17
34 0.13
35 0.07
36 0.06
37 0.06
38 0.06
39 0.05
40 0.05
41 0.05
42 0.06
43 0.08
44 0.09
45 0.1
46 0.1
47 0.1
48 0.13
49 0.15
50 0.16
51 0.16
52 0.17
53 0.19
54 0.19
55 0.24
56 0.27
57 0.31
58 0.32
59 0.32
60 0.32
61 0.3
62 0.3
63 0.3
64 0.27