Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

H1VZ14

Protein Details
Accession H1VZ14    Localization Confidence Medium Confidence Score 10.6
NoLS Segment(s)
PositionSequenceProtein Nature
50-75VSTHPGTQTRRPVKRRRLLTPPRTAGHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 15, mito 7, pero 2, cyto 1, plas 1, extr 1
Family & Domain DBs
InterPro View protein in InterPro  
IPR046797  PDDEXK_12  
Pfam View protein in Pfam  
PF20516  PDDEXK_12  
Amino Acid Sequences MADVSHLQLKVRHWLANLPPPSSSSASPTLDNPPRDDTSCKSERDGPSHVSTHPGTQTRRPVKRRRLLTPPRTAGMSTPSAKHSLSRAASSLSNATSSAQDNDQTPKRIKTAPVLGPFGAPPPPSSRRSGSVSPKKQARNTTTTSIQCRQYDVTQNIPAALKKIWRDMSGYGKGIGVVGFEAKAAVEDAMESQPRFQQEIIHDFVFEPAPPTPPIPTTTGRDAGPRTKLGPTPTVDDVLRIFEDASMCYNKALDEPSWNQAVHSPVLSMATKPIWRLRPGDVVAHVPCTTASIMPVYAEPRGRKVDYCMCIQPDPLSAAAIRAIRDQDVWTNLSINHTEFNALQDMPIAVSIETKPQSGDEADAQGQLAVWQAAQWRLLERLVGRNEPKMPLPDFLPGIVVIGHAWHFVASTKQDADV
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.38
2 0.44
3 0.49
4 0.51
5 0.43
6 0.4
7 0.39
8 0.42
9 0.38
10 0.32
11 0.28
12 0.3
13 0.31
14 0.32
15 0.32
16 0.37
17 0.42
18 0.43
19 0.41
20 0.4
21 0.42
22 0.44
23 0.45
24 0.4
25 0.41
26 0.45
27 0.44
28 0.42
29 0.47
30 0.5
31 0.52
32 0.52
33 0.49
34 0.48
35 0.48
36 0.45
37 0.42
38 0.37
39 0.35
40 0.37
41 0.38
42 0.37
43 0.42
44 0.52
45 0.57
46 0.66
47 0.71
48 0.75
49 0.79
50 0.84
51 0.86
52 0.83
53 0.84
54 0.85
55 0.85
56 0.85
57 0.79
58 0.72
59 0.65
60 0.57
61 0.48
62 0.42
63 0.38
64 0.3
65 0.27
66 0.27
67 0.28
68 0.28
69 0.28
70 0.26
71 0.28
72 0.27
73 0.27
74 0.26
75 0.26
76 0.27
77 0.26
78 0.26
79 0.18
80 0.16
81 0.15
82 0.14
83 0.14
84 0.15
85 0.15
86 0.14
87 0.15
88 0.16
89 0.23
90 0.27
91 0.3
92 0.32
93 0.33
94 0.36
95 0.38
96 0.39
97 0.39
98 0.43
99 0.45
100 0.47
101 0.47
102 0.43
103 0.4
104 0.38
105 0.32
106 0.25
107 0.18
108 0.15
109 0.19
110 0.24
111 0.26
112 0.3
113 0.32
114 0.33
115 0.39
116 0.45
117 0.49
118 0.55
119 0.59
120 0.62
121 0.66
122 0.68
123 0.68
124 0.69
125 0.65
126 0.61
127 0.58
128 0.56
129 0.55
130 0.54
131 0.55
132 0.51
133 0.49
134 0.43
135 0.41
136 0.38
137 0.35
138 0.39
139 0.35
140 0.35
141 0.32
142 0.31
143 0.3
144 0.29
145 0.25
146 0.19
147 0.18
148 0.16
149 0.15
150 0.21
151 0.22
152 0.22
153 0.24
154 0.25
155 0.31
156 0.31
157 0.31
158 0.25
159 0.23
160 0.22
161 0.2
162 0.16
163 0.09
164 0.05
165 0.05
166 0.04
167 0.04
168 0.04
169 0.03
170 0.04
171 0.04
172 0.03
173 0.03
174 0.03
175 0.05
176 0.06
177 0.07
178 0.07
179 0.08
180 0.1
181 0.11
182 0.12
183 0.11
184 0.13
185 0.15
186 0.2
187 0.22
188 0.2
189 0.19
190 0.18
191 0.19
192 0.15
193 0.12
194 0.1
195 0.07
196 0.09
197 0.09
198 0.1
199 0.1
200 0.11
201 0.13
202 0.15
203 0.17
204 0.19
205 0.21
206 0.23
207 0.22
208 0.24
209 0.24
210 0.24
211 0.25
212 0.23
213 0.21
214 0.22
215 0.24
216 0.24
217 0.26
218 0.23
219 0.25
220 0.24
221 0.25
222 0.22
223 0.2
224 0.18
225 0.15
226 0.14
227 0.1
228 0.09
229 0.08
230 0.08
231 0.08
232 0.1
233 0.09
234 0.1
235 0.09
236 0.1
237 0.09
238 0.09
239 0.11
240 0.09
241 0.13
242 0.16
243 0.18
244 0.21
245 0.2
246 0.19
247 0.2
248 0.21
249 0.17
250 0.15
251 0.12
252 0.1
253 0.12
254 0.13
255 0.1
256 0.1
257 0.11
258 0.12
259 0.14
260 0.2
261 0.22
262 0.25
263 0.28
264 0.29
265 0.34
266 0.35
267 0.36
268 0.31
269 0.31
270 0.29
271 0.28
272 0.25
273 0.17
274 0.16
275 0.15
276 0.14
277 0.09
278 0.1
279 0.08
280 0.08
281 0.08
282 0.1
283 0.09
284 0.12
285 0.16
286 0.16
287 0.2
288 0.25
289 0.26
290 0.26
291 0.31
292 0.37
293 0.35
294 0.39
295 0.38
296 0.37
297 0.36
298 0.36
299 0.31
300 0.24
301 0.23
302 0.19
303 0.15
304 0.12
305 0.12
306 0.14
307 0.14
308 0.13
309 0.14
310 0.15
311 0.14
312 0.16
313 0.16
314 0.17
315 0.19
316 0.19
317 0.17
318 0.18
319 0.18
320 0.2
321 0.2
322 0.17
323 0.15
324 0.14
325 0.15
326 0.14
327 0.15
328 0.15
329 0.14
330 0.12
331 0.12
332 0.12
333 0.11
334 0.11
335 0.09
336 0.07
337 0.09
338 0.1
339 0.15
340 0.16
341 0.16
342 0.16
343 0.16
344 0.18
345 0.17
346 0.19
347 0.15
348 0.19
349 0.19
350 0.19
351 0.19
352 0.16
353 0.15
354 0.12
355 0.11
356 0.07
357 0.06
358 0.07
359 0.1
360 0.12
361 0.13
362 0.14
363 0.15
364 0.17
365 0.18
366 0.2
367 0.2
368 0.26
369 0.3
370 0.37
371 0.37
372 0.41
373 0.44
374 0.44
375 0.45
376 0.43
377 0.4
378 0.35
379 0.35
380 0.34
381 0.31
382 0.29
383 0.26
384 0.2
385 0.18
386 0.15
387 0.13
388 0.08
389 0.09
390 0.09
391 0.08
392 0.08
393 0.07
394 0.08
395 0.09
396 0.14
397 0.15
398 0.19