Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A5B0PFQ0

Protein Details
Accession A0A5B0PFQ0   
Localization Confidence Low
Confidence Score 9.2
NoLS Segment(s)
PositionSequenceProtein Nature
93-123SVLNRTPARRPSKKVCSSKSYKKVIHKLNAFHydrophilic
NLS Segment(s)
Subcellular Location(s) cyto 5, cyto_nucl 11.5, mito 6, nucl 16
Family & Domain DBs
Amino Acid Sequences MDFTPTKSSSTPKSLGRVASGPEPGNSLEHDAPAPTKRSSTPESLGRVASGPEPGNSLEHDAPAPTKRSSTPESLGRVASGPEPGNSLEHDASVLNRTPARRPSKKVCSSKSYKKVIHKLNAFIPLTG
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.45
2 0.44
3 0.43
4 0.39
5 0.35
6 0.34
7 0.33
8 0.29
9 0.25
10 0.25
11 0.22
12 0.21
13 0.19
14 0.19
15 0.16
16 0.15
17 0.15
18 0.14
19 0.16
20 0.18
21 0.2
22 0.16
23 0.17
24 0.18
25 0.24
26 0.27
27 0.29
28 0.31
29 0.33
30 0.36
31 0.36
32 0.34
33 0.29
34 0.26
35 0.22
36 0.18
37 0.16
38 0.13
39 0.12
40 0.14
41 0.14
42 0.15
43 0.15
44 0.19
45 0.16
46 0.15
47 0.15
48 0.14
49 0.16
50 0.18
51 0.2
52 0.16
53 0.17
54 0.18
55 0.24
56 0.27
57 0.29
58 0.31
59 0.33
60 0.36
61 0.36
62 0.34
63 0.29
64 0.26
65 0.22
66 0.18
67 0.16
68 0.13
69 0.12
70 0.14
71 0.14
72 0.15
73 0.15
74 0.18
75 0.14
76 0.12
77 0.13
78 0.11
79 0.11
80 0.13
81 0.13
82 0.12
83 0.14
84 0.16
85 0.21
86 0.29
87 0.39
88 0.44
89 0.5
90 0.58
91 0.67
92 0.76
93 0.8
94 0.78
95 0.78
96 0.8
97 0.84
98 0.83
99 0.82
100 0.79
101 0.8
102 0.82
103 0.82
104 0.82
105 0.77
106 0.73
107 0.7
108 0.71