Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A5B0PK17

Protein Details
Accession A0A5B0PK17   
Localization Confidence Low
Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
101-121TPLRAIRRELNRENRNNIRKSHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 26
Family & Domain DBs
InterPro View protein in InterPro  
IPR013870  Ribosomal_L37_mit  
Gene Ontology GO:0005739  C:mitochondrion  
GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
Pfam View protein in Pfam  
PF08561  Ribosomal_L37  
Amino Acid Sequences MSSLIRTGLLRLSSHSESNQICSRAASILRVRHLASQPTQEKKTSQAKKTVPVSTIPAGSPIKGLAYIKGESDPIAKADDEYPSWLWTLLEPNMGVGHADTPLRAIRRELNRENRNNIRKSNFLKAKK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.27
2 0.27
3 0.29
4 0.28
5 0.33
6 0.35
7 0.3
8 0.28
9 0.26
10 0.26
11 0.23
12 0.23
13 0.23
14 0.23
15 0.26
16 0.28
17 0.3
18 0.3
19 0.32
20 0.35
21 0.34
22 0.31
23 0.35
24 0.39
25 0.44
26 0.45
27 0.41
28 0.39
29 0.41
30 0.49
31 0.48
32 0.46
33 0.49
34 0.49
35 0.55
36 0.6
37 0.56
38 0.47
39 0.4
40 0.4
41 0.32
42 0.3
43 0.22
44 0.21
45 0.18
46 0.16
47 0.15
48 0.11
49 0.09
50 0.09
51 0.1
52 0.07
53 0.09
54 0.1
55 0.1
56 0.1
57 0.1
58 0.1
59 0.11
60 0.1
61 0.08
62 0.09
63 0.08
64 0.09
65 0.09
66 0.11
67 0.1
68 0.12
69 0.12
70 0.12
71 0.12
72 0.11
73 0.11
74 0.1
75 0.13
76 0.11
77 0.12
78 0.11
79 0.11
80 0.11
81 0.11
82 0.1
83 0.07
84 0.07
85 0.06
86 0.07
87 0.06
88 0.08
89 0.12
90 0.14
91 0.14
92 0.16
93 0.23
94 0.33
95 0.42
96 0.5
97 0.57
98 0.65
99 0.71
100 0.78
101 0.8
102 0.8
103 0.77
104 0.76
105 0.71
106 0.69
107 0.68
108 0.71