Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A5B0Q6Z9

Protein Details
Accession A0A5B0Q6Z9    Localization Confidence Medium Confidence Score 10.4
NoLS Segment(s)
PositionSequenceProtein Nature
4-33QLPVYMQKLRWLKKKKEKIRSKQPPTPFDQHydrophilic
NLS Segment(s)
PositionSequence
13-25RWLKKKKEKIRSK
Subcellular Location(s) mito 13.5, mito_nucl 12.999, nucl 11, cyto_nucl 8.333
Family & Domain DBs
Amino Acid Sequences MTKQLPVYMQKLRWLKKKKEKIRSKQPPTPFDQKALPERELGKQHQHLSINQLFRVSIRAPHQITSASPAQPTNNDPHTSLNTLSRPPSSLWSTKLST
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.65
2 0.7
3 0.74
4 0.83
5 0.85
6 0.87
7 0.91
8 0.92
9 0.93
10 0.94
11 0.92
12 0.9
13 0.88
14 0.83
15 0.79
16 0.77
17 0.68
18 0.59
19 0.54
20 0.5
21 0.48
22 0.46
23 0.4
24 0.33
25 0.33
26 0.35
27 0.35
28 0.34
29 0.33
30 0.33
31 0.34
32 0.35
33 0.35
34 0.3
35 0.32
36 0.34
37 0.29
38 0.25
39 0.23
40 0.19
41 0.17
42 0.2
43 0.14
44 0.14
45 0.16
46 0.22
47 0.23
48 0.24
49 0.25
50 0.22
51 0.22
52 0.23
53 0.23
54 0.17
55 0.17
56 0.18
57 0.18
58 0.19
59 0.22
60 0.23
61 0.24
62 0.25
63 0.25
64 0.28
65 0.31
66 0.31
67 0.3
68 0.3
69 0.28
70 0.3
71 0.31
72 0.29
73 0.27
74 0.26
75 0.31
76 0.31
77 0.32
78 0.33