Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A5B0PU76

Protein Details
Accession A0A5B0PU76    Localization Confidence Low Confidence Score 9.3
NoLS Segment(s)
PositionSequenceProtein Nature
49-79HQETKPSEHESRRRRRTRKKRIFGSRMAPKSBasic
NLS Segment(s)
PositionSequence
59-78SRRRRRTRKKRIFGSRMAPK
Subcellular Location(s) mito 9, cyto 7, nucl 4, cyto_pero 4, plas 3, extr 3
Family & Domain DBs
InterPro View protein in InterPro  
IPR003038  DAD/Ost2  
Gene Ontology GO:0008250  C:oligosaccharyltransferase complex  
GO:0016740  F:transferase activity  
GO:0006486  P:protein glycosylation  
Pfam View protein in Pfam  
PF02109  DAD  
Amino Acid Sequences MWLSVPWGSPPIPAIPLSPPVPANTTSQSQSSPFFHQKASTRPAIEAEHQETKPSEHESRRRRRTRKKRIFGSRMAPKSKQANTNTSMISSAMKQLTRSYIEETPSSLLLIDSVLVFLIGSAVIQLAYCVLVTSFPFNAFLGAFSVHVGQFVLLASLRSQVNPLNSSQFEFVSPERAFADFVFGSLVLHFFAFNFLG
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.18
2 0.18
3 0.23
4 0.23
5 0.24
6 0.22
7 0.22
8 0.24
9 0.24
10 0.25
11 0.23
12 0.25
13 0.25
14 0.26
15 0.26
16 0.25
17 0.27
18 0.26
19 0.3
20 0.33
21 0.33
22 0.33
23 0.37
24 0.4
25 0.43
26 0.46
27 0.43
28 0.38
29 0.37
30 0.39
31 0.37
32 0.35
33 0.33
34 0.33
35 0.35
36 0.33
37 0.34
38 0.32
39 0.3
40 0.3
41 0.3
42 0.31
43 0.32
44 0.41
45 0.5
46 0.6
47 0.69
48 0.77
49 0.82
50 0.87
51 0.9
52 0.93
53 0.94
54 0.93
55 0.93
56 0.94
57 0.91
58 0.86
59 0.84
60 0.82
61 0.78
62 0.72
63 0.63
64 0.57
65 0.57
66 0.54
67 0.53
68 0.47
69 0.45
70 0.42
71 0.44
72 0.39
73 0.32
74 0.28
75 0.2
76 0.17
77 0.12
78 0.12
79 0.11
80 0.11
81 0.11
82 0.12
83 0.14
84 0.15
85 0.16
86 0.17
87 0.17
88 0.19
89 0.18
90 0.18
91 0.17
92 0.15
93 0.13
94 0.1
95 0.07
96 0.05
97 0.05
98 0.04
99 0.03
100 0.03
101 0.03
102 0.03
103 0.03
104 0.02
105 0.03
106 0.02
107 0.02
108 0.02
109 0.02
110 0.02
111 0.02
112 0.02
113 0.02
114 0.03
115 0.03
116 0.03
117 0.03
118 0.04
119 0.04
120 0.07
121 0.07
122 0.08
123 0.09
124 0.09
125 0.1
126 0.09
127 0.09
128 0.08
129 0.08
130 0.08
131 0.07
132 0.09
133 0.08
134 0.08
135 0.07
136 0.06
137 0.06
138 0.06
139 0.06
140 0.05
141 0.06
142 0.06
143 0.09
144 0.1
145 0.1
146 0.11
147 0.13
148 0.18
149 0.19
150 0.2
151 0.23
152 0.23
153 0.26
154 0.26
155 0.23
156 0.2
157 0.21
158 0.2
159 0.22
160 0.21
161 0.21
162 0.21
163 0.21
164 0.21
165 0.18
166 0.23
167 0.15
168 0.15
169 0.15
170 0.13
171 0.13
172 0.12
173 0.13
174 0.07
175 0.08
176 0.07
177 0.06