Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A5B0QF37

Protein Details
Accession A0A5B0QF37    Localization Confidence High Confidence Score 15.6
NoLS Segment(s)
PositionSequenceProtein Nature
161-184RLYGDKSKPSTKVRKKRLAITTTSHydrophilic
NLS Segment(s)
PositionSequence
166-177KSKPSTKVRKKR
Subcellular Location(s) nucl 19, mito 6
Family & Domain DBs
InterPro View protein in InterPro  
IPR005522  IPK  
IPR038286  IPK_sf  
Gene Ontology GO:0016301  F:kinase activity  
GO:0032958  P:inositol phosphate biosynthetic process  
GO:0016310  P:phosphorylation  
Pfam View protein in Pfam  
PF03770  IPK  
Amino Acid Sequences MVLPLLRQLKSLNLDSYYGDRFRGEEQIIPSLLQRLPFPQFKPCREQEETGPVLIQAGGHQGRLGIYHNDPTRILKETYQDEADFYMHVAPKLDNLLEEPYRGSWKPSILNWEKSSMKKNGRDRAFIVLENIAPVSHHRKAGKDPNYFWHPNVIDIKLGKRLYGDKSKPSTKVRKKRLAITTTSHLLVSESYNIDVS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.28
2 0.29
3 0.32
4 0.3
5 0.26
6 0.23
7 0.2
8 0.2
9 0.21
10 0.25
11 0.23
12 0.22
13 0.24
14 0.27
15 0.28
16 0.26
17 0.25
18 0.23
19 0.22
20 0.19
21 0.17
22 0.17
23 0.22
24 0.27
25 0.28
26 0.34
27 0.41
28 0.44
29 0.52
30 0.52
31 0.55
32 0.55
33 0.56
34 0.51
35 0.51
36 0.48
37 0.4
38 0.35
39 0.27
40 0.22
41 0.19
42 0.14
43 0.06
44 0.1
45 0.1
46 0.1
47 0.1
48 0.1
49 0.1
50 0.11
51 0.13
52 0.1
53 0.11
54 0.17
55 0.19
56 0.2
57 0.2
58 0.22
59 0.22
60 0.22
61 0.22
62 0.18
63 0.21
64 0.22
65 0.25
66 0.24
67 0.22
68 0.19
69 0.19
70 0.17
71 0.13
72 0.1
73 0.1
74 0.09
75 0.09
76 0.09
77 0.08
78 0.09
79 0.1
80 0.09
81 0.07
82 0.07
83 0.1
84 0.1
85 0.1
86 0.1
87 0.09
88 0.12
89 0.12
90 0.13
91 0.11
92 0.14
93 0.16
94 0.16
95 0.25
96 0.27
97 0.32
98 0.32
99 0.35
100 0.36
101 0.36
102 0.41
103 0.39
104 0.42
105 0.44
106 0.51
107 0.55
108 0.56
109 0.57
110 0.53
111 0.52
112 0.47
113 0.39
114 0.33
115 0.25
116 0.21
117 0.18
118 0.16
119 0.09
120 0.07
121 0.1
122 0.15
123 0.16
124 0.21
125 0.22
126 0.25
127 0.33
128 0.43
129 0.49
130 0.49
131 0.49
132 0.53
133 0.59
134 0.59
135 0.51
136 0.5
137 0.41
138 0.39
139 0.4
140 0.33
141 0.29
142 0.29
143 0.3
144 0.3
145 0.29
146 0.25
147 0.23
148 0.27
149 0.31
150 0.39
151 0.42
152 0.43
153 0.51
154 0.57
155 0.61
156 0.66
157 0.71
158 0.71
159 0.77
160 0.79
161 0.82
162 0.82
163 0.85
164 0.86
165 0.81
166 0.75
167 0.71
168 0.67
169 0.6
170 0.55
171 0.45
172 0.35
173 0.29
174 0.25
175 0.2
176 0.18
177 0.16