Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

H1W0V3

Protein Details
Accession H1W0V3    Localization Confidence Medium Confidence Score 13.6
NoLS Segment(s)
PositionSequenceProtein Nature
129-155PEQQSKTQAEKDKKKRSKARVVIEHLDHydrophilic
NLS Segment(s)
PositionSequence
140-146DKKKRSK
Subcellular Location(s) nucl 14, cyto 11
Family & Domain DBs
InterPro View protein in InterPro  
IPR025845  Thg1_C_dom  
IPR024956  tRNAHis_GuaTrfase_cat  
IPR007537  tRNAHis_GuaTrfase_Thg1  
IPR038469  tRNAHis_GuaTrfase_Thg1_sf  
Gene Ontology GO:0005525  F:GTP binding  
GO:0000287  F:magnesium ion binding  
GO:0008193  F:tRNA guanylyltransferase activity  
GO:0006400  P:tRNA modification  
Pfam View protein in Pfam  
PF04446  Thg1  
PF14413  Thg1C  
Amino Acid Sequences MANSKFEYVKSFEQPDFLLPNTWIVVRVDGRGFTKLCAKYNLEKPNDKRALDLMNAAARVVVTELPDITVAYGGTVSGDKNEILFSQFKINYNNEPEMYKKGSVVFRDYELVEPGTHNAAEAADALAEPEQQSKTQAEKDKKKRSKARVVIEHLDIIKDDFWDRRPWLLSNKPGKTPKEP
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.35
2 0.35
3 0.32
4 0.27
5 0.23
6 0.19
7 0.2
8 0.19
9 0.18
10 0.16
11 0.14
12 0.17
13 0.16
14 0.18
15 0.17
16 0.19
17 0.2
18 0.23
19 0.22
20 0.2
21 0.27
22 0.28
23 0.3
24 0.32
25 0.35
26 0.39
27 0.47
28 0.55
29 0.52
30 0.58
31 0.59
32 0.65
33 0.67
34 0.59
35 0.52
36 0.46
37 0.43
38 0.35
39 0.32
40 0.23
41 0.19
42 0.19
43 0.17
44 0.14
45 0.1
46 0.09
47 0.08
48 0.07
49 0.05
50 0.06
51 0.06
52 0.06
53 0.07
54 0.06
55 0.06
56 0.05
57 0.04
58 0.04
59 0.04
60 0.03
61 0.04
62 0.04
63 0.04
64 0.04
65 0.05
66 0.05
67 0.05
68 0.06
69 0.05
70 0.07
71 0.08
72 0.09
73 0.13
74 0.15
75 0.16
76 0.19
77 0.21
78 0.22
79 0.25
80 0.25
81 0.21
82 0.2
83 0.2
84 0.21
85 0.22
86 0.19
87 0.16
88 0.18
89 0.2
90 0.21
91 0.23
92 0.2
93 0.19
94 0.2
95 0.2
96 0.17
97 0.15
98 0.15
99 0.12
100 0.11
101 0.11
102 0.1
103 0.09
104 0.08
105 0.07
106 0.06
107 0.06
108 0.06
109 0.05
110 0.04
111 0.04
112 0.04
113 0.04
114 0.05
115 0.05
116 0.07
117 0.08
118 0.08
119 0.11
120 0.13
121 0.16
122 0.23
123 0.32
124 0.39
125 0.49
126 0.6
127 0.69
128 0.75
129 0.82
130 0.85
131 0.87
132 0.88
133 0.87
134 0.87
135 0.85
136 0.85
137 0.79
138 0.71
139 0.65
140 0.54
141 0.45
142 0.34
143 0.26
144 0.19
145 0.15
146 0.15
147 0.14
148 0.16
149 0.23
150 0.24
151 0.28
152 0.31
153 0.34
154 0.41
155 0.47
156 0.54
157 0.58
158 0.61
159 0.65
160 0.7