Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A5B0NE37

Protein Details
Accession A0A5B0NE37    Localization Confidence Low Confidence Score 7
NoLS Segment(s)
PositionSequenceProtein Nature
2-21SQPNCSSGIRRKRQHSPSVAHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 14.5, mito_nucl 11.5, nucl 7.5, plas 2, golg 2
Family & Domain DBs
Amino Acid Sequences MSQPNCSSGIRRKRQHSPSVAWGVHHMRLMAILALIAILALTESQPVAKDGTSEKKSKDVAKKGIMKHDVERNRNERDEGMINEDGGNERSRQRDRLEVSSLS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.78
2 0.81
3 0.79
4 0.74
5 0.73
6 0.73
7 0.66
8 0.56
9 0.53
10 0.47
11 0.41
12 0.35
13 0.26
14 0.17
15 0.17
16 0.16
17 0.11
18 0.07
19 0.05
20 0.04
21 0.04
22 0.03
23 0.03
24 0.02
25 0.02
26 0.02
27 0.02
28 0.02
29 0.02
30 0.02
31 0.03
32 0.03
33 0.04
34 0.05
35 0.05
36 0.06
37 0.09
38 0.17
39 0.2
40 0.22
41 0.22
42 0.26
43 0.29
44 0.35
45 0.41
46 0.41
47 0.44
48 0.5
49 0.56
50 0.55
51 0.6
52 0.57
53 0.51
54 0.48
55 0.51
56 0.51
57 0.49
58 0.54
59 0.51
60 0.53
61 0.52
62 0.49
63 0.41
64 0.37
65 0.37
66 0.3
67 0.31
68 0.25
69 0.24
70 0.22
71 0.22
72 0.19
73 0.16
74 0.16
75 0.12
76 0.16
77 0.23
78 0.27
79 0.32
80 0.34
81 0.42
82 0.46
83 0.5