Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A5B0LX95

Protein Details
Accession A0A5B0LX95   
Localization Confidence Medium
Confidence Score 11.7
NoLS Segment(s)
PositionSequenceProtein Nature
17-47GHTLIVRNTRKVPKKKRKRGYTRAADRDPIHBasic
NLS Segment(s)
PositionSequence
26-36RKVPKKKRKRG
63-82RAASNRGKKSITKGKAKAQK
Subcellular Location(s) cyto_nucl 4, mito 21, nucl 5
Family & Domain DBs
Amino Acid Sequences MAKLRQVRSNTHVVPLGHTLIVRNTRKVPKKKRKRGYTRAADRDPIHAEVVEAQVNQAQAQKRAASNRGKKSITKGKAKAQKSPASDKTTTSDESAVQPNPVTCKRKQPTRSTRAAKLFKQSVHSDLGEASSSASESEYVSSSAGCTGGLDADDQPNASCEPWEKEDAQSNVVSGADHQATASRSGSDTGGCAKGSILEQPHSGQAMETADVELPSDLEQMIPQVFRLSRSHIPHLSCHKNG
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.42
2 0.39
3 0.36
4 0.27
5 0.25
6 0.22
7 0.23
8 0.32
9 0.32
10 0.32
11 0.38
12 0.48
13 0.58
14 0.67
15 0.72
16 0.75
17 0.83
18 0.9
19 0.93
20 0.94
21 0.95
22 0.95
23 0.95
24 0.94
25 0.94
26 0.93
27 0.86
28 0.81
29 0.71
30 0.66
31 0.58
32 0.49
33 0.39
34 0.29
35 0.25
36 0.2
37 0.2
38 0.17
39 0.13
40 0.11
41 0.12
42 0.12
43 0.12
44 0.15
45 0.15
46 0.16
47 0.19
48 0.21
49 0.23
50 0.27
51 0.34
52 0.4
53 0.47
54 0.53
55 0.58
56 0.58
57 0.57
58 0.62
59 0.65
60 0.62
61 0.63
62 0.59
63 0.61
64 0.67
65 0.68
66 0.67
67 0.65
68 0.63
69 0.59
70 0.62
71 0.6
72 0.58
73 0.56
74 0.5
75 0.45
76 0.41
77 0.37
78 0.3
79 0.24
80 0.18
81 0.19
82 0.21
83 0.18
84 0.16
85 0.15
86 0.14
87 0.18
88 0.23
89 0.25
90 0.23
91 0.34
92 0.38
93 0.47
94 0.54
95 0.6
96 0.64
97 0.68
98 0.76
99 0.71
100 0.73
101 0.73
102 0.71
103 0.63
104 0.58
105 0.54
106 0.46
107 0.45
108 0.38
109 0.32
110 0.29
111 0.26
112 0.2
113 0.16
114 0.16
115 0.11
116 0.1
117 0.08
118 0.05
119 0.05
120 0.05
121 0.05
122 0.04
123 0.04
124 0.05
125 0.06
126 0.06
127 0.06
128 0.06
129 0.06
130 0.06
131 0.06
132 0.05
133 0.04
134 0.04
135 0.04
136 0.04
137 0.05
138 0.05
139 0.06
140 0.07
141 0.07
142 0.07
143 0.08
144 0.08
145 0.07
146 0.07
147 0.08
148 0.12
149 0.15
150 0.18
151 0.18
152 0.2
153 0.27
154 0.28
155 0.28
156 0.24
157 0.21
158 0.19
159 0.18
160 0.15
161 0.09
162 0.11
163 0.09
164 0.08
165 0.08
166 0.11
167 0.11
168 0.14
169 0.14
170 0.11
171 0.12
172 0.13
173 0.14
174 0.11
175 0.11
176 0.12
177 0.14
178 0.13
179 0.12
180 0.11
181 0.13
182 0.13
183 0.16
184 0.16
185 0.16
186 0.18
187 0.19
188 0.21
189 0.2
190 0.19
191 0.15
192 0.14
193 0.14
194 0.13
195 0.12
196 0.11
197 0.11
198 0.11
199 0.11
200 0.09
201 0.08
202 0.08
203 0.08
204 0.07
205 0.07
206 0.07
207 0.08
208 0.1
209 0.1
210 0.1
211 0.14
212 0.15
213 0.18
214 0.21
215 0.26
216 0.32
217 0.39
218 0.46
219 0.47
220 0.49
221 0.54
222 0.61