Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A5B0MMW3

Protein Details
Accession A0A5B0MMW3    Localization Confidence High Confidence Score 21.4
NoLS Segment(s)
PositionSequenceProtein Nature
211-235AKSNTKAPFKSKKPKKSTLPAGLEKHydrophilic
242-271DYRVKCLQSKERRESKRMRLERRRIRIEESBasic
NLS Segment(s)
PositionSequence
6-6K
218-226PFKSKKPKK
252-267ERRESKRMRLERRRIR
Subcellular Location(s) nucl 20, mito 4, cyto 3
Family & Domain DBs
Amino Acid Sequences MPPRKKKNPPAPTPTTTPAQSRPAAPKRKQPVSWEKDGVDGFSSIRILIEWLTSDGNFKRWRGKKGNGLNKEALASEVVALMVSHGIHHRNNKDIRTKIQELQDNYSAACDWLRNTGSGVLDEDIANGTDNVRAAVIKRCKYFYDLDEVMRERTCAIPEDIVDTTSGDVPDIINPPSEGPEGVLDPLIDSIGEGNEGSDQDGSVADSGTAAKSNTKAPFKSKKPKKSTLPAGLEKAIQDTSDYRVKCLQSKERRESKRMRLERRRIRIEESDAKVRRVLAEAEQAKLRISCMKELKESGFADEDISKFLQQQFGQGPSHQSDTESSDDVDTD
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.74
2 0.68
3 0.6
4 0.55
5 0.51
6 0.49
7 0.46
8 0.44
9 0.5
10 0.55
11 0.62
12 0.62
13 0.67
14 0.7
15 0.77
16 0.76
17 0.75
18 0.77
19 0.74
20 0.77
21 0.72
22 0.63
23 0.59
24 0.54
25 0.45
26 0.36
27 0.29
28 0.2
29 0.17
30 0.16
31 0.11
32 0.1
33 0.09
34 0.08
35 0.08
36 0.08
37 0.08
38 0.09
39 0.1
40 0.1
41 0.15
42 0.15
43 0.21
44 0.24
45 0.25
46 0.34
47 0.4
48 0.49
49 0.54
50 0.61
51 0.64
52 0.71
53 0.8
54 0.76
55 0.76
56 0.69
57 0.61
58 0.54
59 0.44
60 0.34
61 0.24
62 0.17
63 0.11
64 0.08
65 0.07
66 0.06
67 0.05
68 0.05
69 0.05
70 0.05
71 0.05
72 0.07
73 0.1
74 0.14
75 0.21
76 0.23
77 0.31
78 0.36
79 0.41
80 0.48
81 0.49
82 0.52
83 0.54
84 0.56
85 0.53
86 0.55
87 0.55
88 0.49
89 0.5
90 0.47
91 0.39
92 0.34
93 0.29
94 0.23
95 0.17
96 0.14
97 0.1
98 0.07
99 0.11
100 0.12
101 0.12
102 0.12
103 0.14
104 0.14
105 0.14
106 0.15
107 0.11
108 0.11
109 0.1
110 0.09
111 0.07
112 0.07
113 0.07
114 0.06
115 0.05
116 0.06
117 0.06
118 0.06
119 0.05
120 0.05
121 0.07
122 0.15
123 0.21
124 0.25
125 0.26
126 0.28
127 0.29
128 0.32
129 0.34
130 0.27
131 0.28
132 0.26
133 0.25
134 0.26
135 0.26
136 0.24
137 0.21
138 0.2
139 0.13
140 0.12
141 0.12
142 0.1
143 0.1
144 0.1
145 0.1
146 0.12
147 0.12
148 0.11
149 0.1
150 0.09
151 0.08
152 0.08
153 0.08
154 0.05
155 0.05
156 0.05
157 0.06
158 0.08
159 0.08
160 0.07
161 0.07
162 0.08
163 0.09
164 0.09
165 0.07
166 0.07
167 0.07
168 0.07
169 0.07
170 0.07
171 0.06
172 0.05
173 0.05
174 0.05
175 0.04
176 0.03
177 0.03
178 0.03
179 0.03
180 0.03
181 0.03
182 0.04
183 0.04
184 0.05
185 0.05
186 0.05
187 0.05
188 0.05
189 0.05
190 0.05
191 0.04
192 0.04
193 0.04
194 0.05
195 0.05
196 0.05
197 0.06
198 0.07
199 0.08
200 0.14
201 0.19
202 0.23
203 0.25
204 0.33
205 0.42
206 0.51
207 0.61
208 0.66
209 0.71
210 0.75
211 0.83
212 0.84
213 0.84
214 0.85
215 0.84
216 0.81
217 0.75
218 0.7
219 0.62
220 0.53
221 0.43
222 0.35
223 0.25
224 0.17
225 0.14
226 0.11
227 0.14
228 0.19
229 0.19
230 0.19
231 0.24
232 0.26
233 0.3
234 0.37
235 0.43
236 0.48
237 0.58
238 0.66
239 0.71
240 0.76
241 0.79
242 0.81
243 0.81
244 0.82
245 0.82
246 0.83
247 0.84
248 0.88
249 0.9
250 0.9
251 0.89
252 0.81
253 0.78
254 0.73
255 0.71
256 0.69
257 0.64
258 0.64
259 0.58
260 0.56
261 0.51
262 0.45
263 0.37
264 0.3
265 0.27
266 0.2
267 0.28
268 0.28
269 0.29
270 0.3
271 0.29
272 0.28
273 0.26
274 0.24
275 0.2
276 0.21
277 0.27
278 0.32
279 0.36
280 0.4
281 0.43
282 0.44
283 0.45
284 0.43
285 0.38
286 0.33
287 0.29
288 0.27
289 0.26
290 0.24
291 0.2
292 0.21
293 0.18
294 0.18
295 0.2
296 0.25
297 0.22
298 0.28
299 0.29
300 0.32
301 0.34
302 0.33
303 0.36
304 0.33
305 0.36
306 0.31
307 0.27
308 0.26
309 0.28
310 0.3
311 0.26
312 0.24