Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

H1V179

Protein Details
Accession H1V179    Localization Confidence Low Confidence Score 9.9
NoLS Segment(s)
PositionSequenceProtein Nature
81-108VVLMVLTHTRRRRRRGSRKDEWRMCPSAHydrophilic
NLS Segment(s)
PositionSequence
90-99RRRRRRGSRK
Subcellular Location(s) mito 11, cyto 8.5, cyto_nucl 8, nucl 6.5
Family & Domain DBs
Amino Acid Sequences GPRVVLKCRGGGGAGHRERSCDDPTLQRYVEYRVDGDGTRTLDDDCVLQHKYSVLGPRPLSPSVAEPTCKSPLSTHPAVIVVLMVLTHTRRRRRRGSRKDEWRMCPSANT
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.34
2 0.37
3 0.36
4 0.37
5 0.38
6 0.4
7 0.36
8 0.29
9 0.28
10 0.31
11 0.35
12 0.38
13 0.36
14 0.34
15 0.32
16 0.33
17 0.34
18 0.26
19 0.23
20 0.18
21 0.2
22 0.18
23 0.19
24 0.17
25 0.15
26 0.14
27 0.14
28 0.13
29 0.12
30 0.12
31 0.1
32 0.07
33 0.09
34 0.1
35 0.09
36 0.09
37 0.09
38 0.1
39 0.11
40 0.15
41 0.15
42 0.19
43 0.19
44 0.22
45 0.25
46 0.24
47 0.23
48 0.19
49 0.2
50 0.18
51 0.19
52 0.18
53 0.16
54 0.2
55 0.23
56 0.22
57 0.2
58 0.19
59 0.24
60 0.3
61 0.3
62 0.27
63 0.24
64 0.25
65 0.24
66 0.22
67 0.15
68 0.07
69 0.06
70 0.05
71 0.04
72 0.04
73 0.06
74 0.14
75 0.21
76 0.31
77 0.4
78 0.49
79 0.6
80 0.7
81 0.8
82 0.84
83 0.88
84 0.89
85 0.92
86 0.95
87 0.93
88 0.9
89 0.86
90 0.79