Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A5B0QNC6

Protein Details
Accession A0A5B0QNC6   
Localization Confidence Medium
Confidence Score 14.6
NoLS Segment(s)
PositionSequenceProtein Nature
10-41TNTPTPTPSSPKKKKEEKQSKKKSTPPKETTTHydrophilic
NLS Segment(s)
PositionSequence
20-35PKKKKEEKQSKKKSTP
Subcellular Location(s) cyto 2, cyto_mito 2, cyto_pero 2, mito 2, nucl 19, pero 2
Family & Domain DBs
Amino Acid Sequences MADTDPKSSTNTPTPTPSSPKKKKEEKQSKKKSTPPKETTTDTPKNKQPTDIATPQPADKCIIELWSGMLADRFGEVVCGRSCWGGWLVGPRVEDCQSITGTDPRPL
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.44
2 0.44
3 0.5
4 0.54
5 0.57
6 0.63
7 0.69
8 0.73
9 0.79
10 0.82
11 0.86
12 0.87
13 0.87
14 0.89
15 0.91
16 0.92
17 0.9
18 0.9
19 0.9
20 0.89
21 0.88
22 0.84
23 0.79
24 0.73
25 0.69
26 0.67
27 0.65
28 0.64
29 0.58
30 0.56
31 0.55
32 0.57
33 0.53
34 0.49
35 0.42
36 0.38
37 0.39
38 0.39
39 0.35
40 0.3
41 0.3
42 0.29
43 0.28
44 0.23
45 0.18
46 0.13
47 0.13
48 0.11
49 0.11
50 0.1
51 0.09
52 0.09
53 0.08
54 0.08
55 0.07
56 0.07
57 0.06
58 0.05
59 0.06
60 0.05
61 0.04
62 0.06
63 0.06
64 0.09
65 0.09
66 0.1
67 0.1
68 0.11
69 0.11
70 0.11
71 0.12
72 0.1
73 0.11
74 0.17
75 0.19
76 0.21
77 0.22
78 0.21
79 0.24
80 0.25
81 0.24
82 0.19
83 0.19
84 0.17
85 0.17
86 0.2
87 0.22