Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A5B0P092

Protein Details
Accession A0A5B0P092    Localization Confidence Medium Confidence Score 11.6
NoLS Segment(s)
PositionSequenceProtein Nature
76-100RSIGSWPTKKRAKRDHKLDCSWSRVHydrophilic
NLS Segment(s)
PositionSequence
85-86KR
Subcellular Location(s) nucl 17.5, mito_nucl 12.666, cyto_nucl 11.333, mito 6.5
Family & Domain DBs
Amino Acid Sequences MHTTTGKDLHLHTTSFPNRLKAQPASPTGPRTPKPPADAAPGGGAMECTKNPTDGSLPHTLSRRADPSSISKPQTRSIGSWPTKKRAKRDHKLDCSWSRVWQRTTLTLQHH
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.34
2 0.38
3 0.39
4 0.37
5 0.39
6 0.41
7 0.46
8 0.4
9 0.42
10 0.42
11 0.44
12 0.44
13 0.44
14 0.46
15 0.45
16 0.48
17 0.44
18 0.42
19 0.45
20 0.44
21 0.44
22 0.43
23 0.4
24 0.4
25 0.39
26 0.35
27 0.29
28 0.24
29 0.2
30 0.16
31 0.13
32 0.07
33 0.07
34 0.06
35 0.07
36 0.08
37 0.08
38 0.08
39 0.1
40 0.11
41 0.11
42 0.16
43 0.18
44 0.19
45 0.21
46 0.23
47 0.23
48 0.23
49 0.24
50 0.23
51 0.19
52 0.19
53 0.19
54 0.23
55 0.29
56 0.33
57 0.34
58 0.35
59 0.36
60 0.39
61 0.42
62 0.38
63 0.33
64 0.33
65 0.41
66 0.42
67 0.49
68 0.5
69 0.54
70 0.6
71 0.63
72 0.67
73 0.68
74 0.73
75 0.75
76 0.81
77 0.83
78 0.85
79 0.87
80 0.87
81 0.82
82 0.77
83 0.69
84 0.66
85 0.64
86 0.62
87 0.57
88 0.54
89 0.52
90 0.53
91 0.56