Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A5B0NT89

Protein Details
Accession A0A5B0NT89    Localization Confidence Low Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
62-83VLKCCTTKTIKHPKATKDCKAPHydrophilic
NLS Segment(s)
Subcellular Location(s) extr 26
Family & Domain DBs
Amino Acid Sequences MKSITSIVACVFSALGFFIGHATSLTPSESPSCPSDHPLLLCDGGIDGVVEPVEGKCPGQTVLKCCTTKTIKHPKATKDCKAP
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.07
2 0.07
3 0.05
4 0.05
5 0.06
6 0.06
7 0.06
8 0.06
9 0.06
10 0.06
11 0.07
12 0.08
13 0.07
14 0.08
15 0.11
16 0.11
17 0.13
18 0.14
19 0.16
20 0.16
21 0.19
22 0.2
23 0.19
24 0.18
25 0.17
26 0.16
27 0.14
28 0.13
29 0.1
30 0.07
31 0.06
32 0.05
33 0.04
34 0.03
35 0.03
36 0.03
37 0.03
38 0.03
39 0.03
40 0.05
41 0.05
42 0.06
43 0.06
44 0.07
45 0.09
46 0.15
47 0.18
48 0.2
49 0.26
50 0.34
51 0.34
52 0.34
53 0.41
54 0.4
55 0.43
56 0.5
57 0.56
58 0.56
59 0.65
60 0.72
61 0.74
62 0.8
63 0.83