Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A5B0NE59

Protein Details
Accession A0A5B0NE59   
Localization Confidence Low
Confidence Score 8.4
NoLS Segment(s)
PositionSequenceProtein Nature
5-31QWPTTRSPLACKKKPGRQKNGILHIVTHydrophilic
NLS Segment(s)
Subcellular Location(s) cyto_nucl 10.833, mito 7.5, mito_nucl 12.166, nucl 15.5
Family & Domain DBs
Amino Acid Sequences MVLSQWPTTRSPLACKKKPGRQKNGILHIVTVASESQPTIAQPLDVPEGINIHTSTTHSNKPVSGSAAGKRKLSVSGPSVMTGPVRAPPNLHLPIKNSSKMPKQETNSQPPEGAPNNSQ
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.56
2 0.65
3 0.7
4 0.74
5 0.83
6 0.85
7 0.84
8 0.84
9 0.87
10 0.86
11 0.86
12 0.82
13 0.71
14 0.61
15 0.51
16 0.41
17 0.3
18 0.21
19 0.12
20 0.07
21 0.07
22 0.06
23 0.06
24 0.06
25 0.06
26 0.07
27 0.07
28 0.07
29 0.07
30 0.09
31 0.1
32 0.09
33 0.1
34 0.08
35 0.09
36 0.09
37 0.1
38 0.08
39 0.07
40 0.07
41 0.08
42 0.11
43 0.14
44 0.16
45 0.16
46 0.17
47 0.17
48 0.18
49 0.18
50 0.17
51 0.16
52 0.16
53 0.19
54 0.26
55 0.28
56 0.26
57 0.25
58 0.24
59 0.24
60 0.24
61 0.23
62 0.18
63 0.21
64 0.21
65 0.21
66 0.21
67 0.19
68 0.17
69 0.14
70 0.12
71 0.12
72 0.14
73 0.13
74 0.14
75 0.17
76 0.24
77 0.3
78 0.32
79 0.29
80 0.31
81 0.38
82 0.43
83 0.43
84 0.38
85 0.4
86 0.46
87 0.52
88 0.56
89 0.56
90 0.57
91 0.64
92 0.7
93 0.73
94 0.7
95 0.64
96 0.58
97 0.5
98 0.52
99 0.46