Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A5B0RRW6

Protein Details
Accession A0A5B0RRW6    Localization Confidence Low Confidence Score 8.6
NoLS Segment(s)
PositionSequenceProtein Nature
159-187DEFQKKAKSTVPKAPKKKEEKPGGAPPPGBasic
NLS Segment(s)
PositionSequence
163-190KKAKSTVPKAPKKKEEKPGGAPPPGSAK
Subcellular Location(s) mito 18.5, cyto_mito 10.833, cyto_nucl 2.833, nucl 2.5, cyto 2, pero 2
Family & Domain DBs
InterPro View protein in InterPro  
IPR008972  Cupredoxin  
Amino Acid Sequences MRRSFYFYQPLAWWAFFLLAKLSHAPPPDAPGGQPTPEAAGGQNAKVHVVNVMVGQNGLKFAPPTVNASLHDQIVYTFFAKNHTVTETSLEEPCTPLPNVNAFHSGFVTVSMNAVEYPTQILTVNTTKPIYIACVQKMHCEMGMVAGVNLPASGPGSFDEFQKKAKSTVPKAPKKKEEKPGGAPPPGSAK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.19
2 0.2
3 0.16
4 0.15
5 0.14
6 0.12
7 0.14
8 0.17
9 0.18
10 0.19
11 0.21
12 0.23
13 0.21
14 0.25
15 0.26
16 0.23
17 0.22
18 0.24
19 0.24
20 0.23
21 0.23
22 0.18
23 0.17
24 0.17
25 0.17
26 0.12
27 0.15
28 0.15
29 0.16
30 0.17
31 0.15
32 0.16
33 0.15
34 0.15
35 0.1
36 0.09
37 0.09
38 0.09
39 0.09
40 0.08
41 0.08
42 0.08
43 0.07
44 0.08
45 0.07
46 0.06
47 0.05
48 0.06
49 0.09
50 0.1
51 0.14
52 0.15
53 0.17
54 0.18
55 0.23
56 0.24
57 0.21
58 0.2
59 0.16
60 0.13
61 0.13
62 0.13
63 0.09
64 0.09
65 0.08
66 0.11
67 0.13
68 0.13
69 0.13
70 0.13
71 0.13
72 0.13
73 0.15
74 0.14
75 0.15
76 0.15
77 0.15
78 0.13
79 0.13
80 0.13
81 0.12
82 0.1
83 0.09
84 0.1
85 0.13
86 0.14
87 0.15
88 0.18
89 0.15
90 0.16
91 0.15
92 0.14
93 0.11
94 0.1
95 0.1
96 0.06
97 0.06
98 0.06
99 0.06
100 0.05
101 0.06
102 0.05
103 0.04
104 0.05
105 0.05
106 0.06
107 0.06
108 0.06
109 0.09
110 0.12
111 0.12
112 0.14
113 0.14
114 0.13
115 0.13
116 0.13
117 0.14
118 0.16
119 0.19
120 0.2
121 0.25
122 0.26
123 0.29
124 0.31
125 0.29
126 0.24
127 0.21
128 0.18
129 0.14
130 0.15
131 0.11
132 0.09
133 0.08
134 0.08
135 0.07
136 0.07
137 0.05
138 0.04
139 0.05
140 0.05
141 0.05
142 0.06
143 0.12
144 0.12
145 0.15
146 0.22
147 0.22
148 0.26
149 0.31
150 0.32
151 0.29
152 0.36
153 0.44
154 0.44
155 0.53
156 0.6
157 0.65
158 0.74
159 0.81
160 0.85
161 0.84
162 0.87
163 0.88
164 0.88
165 0.86
166 0.84
167 0.84
168 0.82
169 0.78
170 0.69