Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A5B0P254

Protein Details
Accession A0A5B0P254    Localization Confidence High Confidence Score 19.9
NoLS Segment(s)
PositionSequenceProtein Nature
76-105RSRSRSYSSSRSRSPRRKRGRSYSGPGSRSHydrophilic
277-319SRPAGRPNRSRTPPYRRKRSLSRSPSRSSRRGVRRPSPQYGGRHydrophilic
NLS Segment(s)
PositionSequence
32-65LKKSKASPRSRSPSGSRRSSRAASVKSRRSDSRS
75-111SRSRSRSYSSSRSRSPRRKRGRSYSGPGSRSRSRSRS
245-324PRGPNIPRRNGSPPRRSFGGRSRSPPRRSFADSRPAGRPNRSRTPPYRRKRSLSRSPSRSSRRGVRRPSPQYGGRSSRRN
Subcellular Location(s) nucl 22.5, cyto_nucl 12.5, mito 3
Family & Domain DBs
InterPro View protein in InterPro  
IPR012677  Nucleotide-bd_a/b_plait_sf  
IPR035979  RBD_domain_sf  
IPR034201  RNPS1_RRM  
IPR000504  RRM_dom  
Gene Ontology GO:0005634  C:nucleus  
GO:0003723  F:RNA binding  
Pfam View protein in Pfam  
PF00076  RRM_1  
PROSITE View protein in PROSITE  
PS50102  RRM  
CDD cd12365  RRM_RNPS1  
Amino Acid Sequences MASPRGRSASPKPLRTENLSSKTGVQDPPNGLKKSKASPRSRSPSGSRRSSRAASVKSRRSDSRSMSLSRSSSDSRSRSRSYSSSRSRSPRRKRGRSYSGPGSRSRSRSRSRSASYSSYSSRSDSRDSAERTGGGSKVVEVSKLTKNVTAEHVREIFKVYGTIREVDLPIVRRIGSHRGTAIVTYDTDKAAQKAVSHMNRGQLDGSLISVQIYRSPSPPRGPAALRRGSTTYRATSGNGNRYAAPRGPNIPRRNGSPPRRSFGGRSRSPPRRSFADSRPAGRPNRSRTPPYRRKRSLSRSPSRSSRRGVRRPSPQYGGRSSRRNRSYSRSDSSSYTRSSVSRSRSPRK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.67
2 0.68
3 0.69
4 0.68
5 0.66
6 0.61
7 0.57
8 0.51
9 0.5
10 0.48
11 0.43
12 0.36
13 0.36
14 0.39
15 0.47
16 0.53
17 0.51
18 0.47
19 0.48
20 0.5
21 0.53
22 0.57
23 0.58
24 0.59
25 0.66
26 0.76
27 0.79
28 0.79
29 0.77
30 0.76
31 0.75
32 0.75
33 0.76
34 0.7
35 0.66
36 0.67
37 0.63
38 0.62
39 0.61
40 0.6
41 0.6
42 0.65
43 0.68
44 0.67
45 0.7
46 0.68
47 0.66
48 0.66
49 0.62
50 0.61
51 0.58
52 0.55
53 0.53
54 0.52
55 0.46
56 0.4
57 0.38
58 0.32
59 0.32
60 0.37
61 0.39
62 0.4
63 0.46
64 0.48
65 0.46
66 0.49
67 0.51
68 0.51
69 0.56
70 0.59
71 0.59
72 0.64
73 0.71
74 0.76
75 0.8
76 0.83
77 0.83
78 0.85
79 0.88
80 0.9
81 0.91
82 0.91
83 0.9
84 0.87
85 0.86
86 0.83
87 0.76
88 0.7
89 0.67
90 0.63
91 0.6
92 0.59
93 0.57
94 0.57
95 0.61
96 0.65
97 0.67
98 0.65
99 0.65
100 0.63
101 0.59
102 0.54
103 0.51
104 0.45
105 0.4
106 0.36
107 0.31
108 0.29
109 0.27
110 0.27
111 0.24
112 0.25
113 0.29
114 0.31
115 0.32
116 0.3
117 0.27
118 0.25
119 0.26
120 0.22
121 0.15
122 0.12
123 0.1
124 0.12
125 0.12
126 0.11
127 0.1
128 0.13
129 0.16
130 0.19
131 0.19
132 0.18
133 0.19
134 0.2
135 0.25
136 0.26
137 0.23
138 0.24
139 0.27
140 0.25
141 0.25
142 0.26
143 0.21
144 0.16
145 0.17
146 0.14
147 0.14
148 0.15
149 0.15
150 0.13
151 0.13
152 0.13
153 0.12
154 0.14
155 0.12
156 0.12
157 0.12
158 0.11
159 0.11
160 0.13
161 0.19
162 0.19
163 0.17
164 0.17
165 0.18
166 0.18
167 0.17
168 0.16
169 0.1
170 0.09
171 0.1
172 0.1
173 0.09
174 0.1
175 0.11
176 0.1
177 0.11
178 0.11
179 0.1
180 0.13
181 0.2
182 0.21
183 0.24
184 0.25
185 0.3
186 0.29
187 0.3
188 0.26
189 0.19
190 0.17
191 0.14
192 0.13
193 0.07
194 0.06
195 0.06
196 0.06
197 0.06
198 0.08
199 0.11
200 0.11
201 0.14
202 0.18
203 0.22
204 0.25
205 0.28
206 0.28
207 0.3
208 0.32
209 0.36
210 0.41
211 0.43
212 0.4
213 0.4
214 0.4
215 0.37
216 0.39
217 0.35
218 0.29
219 0.25
220 0.25
221 0.24
222 0.29
223 0.33
224 0.36
225 0.34
226 0.33
227 0.33
228 0.34
229 0.36
230 0.32
231 0.28
232 0.24
233 0.28
234 0.35
235 0.42
236 0.46
237 0.5
238 0.5
239 0.52
240 0.59
241 0.63
242 0.65
243 0.66
244 0.67
245 0.64
246 0.65
247 0.62
248 0.59
249 0.58
250 0.59
251 0.54
252 0.56
253 0.61
254 0.67
255 0.72
256 0.71
257 0.67
258 0.63
259 0.65
260 0.65
261 0.62
262 0.63
263 0.6
264 0.59
265 0.6
266 0.61
267 0.58
268 0.59
269 0.6
270 0.58
271 0.63
272 0.66
273 0.68
274 0.71
275 0.78
276 0.8
277 0.82
278 0.85
279 0.83
280 0.85
281 0.87
282 0.88
283 0.87
284 0.88
285 0.88
286 0.85
287 0.84
288 0.86
289 0.84
290 0.8
291 0.77
292 0.76
293 0.76
294 0.78
295 0.8
296 0.79
297 0.81
298 0.83
299 0.83
300 0.81
301 0.77
302 0.74
303 0.73
304 0.73
305 0.69
306 0.71
307 0.7
308 0.73
309 0.73
310 0.73
311 0.7
312 0.69
313 0.72
314 0.71
315 0.72
316 0.67
317 0.63
318 0.62
319 0.62
320 0.59
321 0.51
322 0.45
323 0.39
324 0.35
325 0.39
326 0.41
327 0.42
328 0.46