Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A5B0LW53

Protein Details
Accession A0A5B0LW53    Localization Confidence Medium Confidence Score 13.3
NoLS Segment(s)
PositionSequenceProtein Nature
80-108SLDIVKKRQESRPQRPKPNKPKRAVSSSMHydrophilic
NLS Segment(s)
PositionSequence
85-102KKRQESRPQRPKPNKPKR
Subcellular Location(s) nucl 19, cyto_nucl 12, mito 5
Family & Domain DBs
Amino Acid Sequences MGNSINCQGHKGACAVVQPGLKTATCIDGQSESPLSISNTDLLARRKANNHQGYREACVVSLPINKDASLPPMSPLPTYSLDIVKKRQESRPQRPKPNKPKRAVSSSMVQAMSHRVPKP
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.18
2 0.18
3 0.2
4 0.2
5 0.19
6 0.19
7 0.2
8 0.18
9 0.17
10 0.17
11 0.16
12 0.15
13 0.15
14 0.14
15 0.14
16 0.15
17 0.16
18 0.16
19 0.13
20 0.12
21 0.13
22 0.12
23 0.11
24 0.11
25 0.09
26 0.09
27 0.1
28 0.14
29 0.15
30 0.19
31 0.2
32 0.22
33 0.25
34 0.31
35 0.4
36 0.45
37 0.47
38 0.45
39 0.49
40 0.48
41 0.47
42 0.42
43 0.32
44 0.23
45 0.19
46 0.17
47 0.12
48 0.13
49 0.11
50 0.12
51 0.12
52 0.12
53 0.13
54 0.13
55 0.15
56 0.15
57 0.14
58 0.13
59 0.15
60 0.15
61 0.15
62 0.15
63 0.15
64 0.15
65 0.16
66 0.16
67 0.19
68 0.22
69 0.25
70 0.29
71 0.32
72 0.36
73 0.39
74 0.45
75 0.51
76 0.59
77 0.67
78 0.73
79 0.77
80 0.82
81 0.89
82 0.92
83 0.93
84 0.94
85 0.93
86 0.9
87 0.91
88 0.88
89 0.85
90 0.79
91 0.72
92 0.68
93 0.62
94 0.6
95 0.49
96 0.41
97 0.34
98 0.35
99 0.36