Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A5B0M8N1

Protein Details
Accession A0A5B0M8N1   
Localization Confidence Medium
Confidence Score 10.7
NoLS Segment(s)
PositionSequenceProtein Nature
105-135SLEDKDPKPKPKTRKVSKVHKYIKQKKDLGDBasic
NLS Segment(s)
PositionSequence
111-129PKPKPKTRKVSKVHKYIKQ
Subcellular Location(s) cyto 6.5, cyto_mito 7.833, mito 8, mito_nucl 10.833, nucl 12.5
Family & Domain DBs
Amino Acid Sequences MQLLSKLVSYNFIESEPADRKCVKEEMKDLVVDEEKNFGTDEALGLWKRWRALHQKVSCSGCKEGYMAQTGGKKQLRLECKACLTKLGATAGGQHLSRLLNQEVSLEDKDPKPKPKTRKVSKVHKYIKQKKDLGDILEEEVSGEAAP
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.17
2 0.23
3 0.25
4 0.25
5 0.27
6 0.27
7 0.28
8 0.31
9 0.39
10 0.37
11 0.37
12 0.4
13 0.43
14 0.44
15 0.43
16 0.39
17 0.35
18 0.32
19 0.26
20 0.22
21 0.19
22 0.16
23 0.16
24 0.16
25 0.12
26 0.1
27 0.09
28 0.09
29 0.07
30 0.1
31 0.1
32 0.1
33 0.12
34 0.13
35 0.15
36 0.16
37 0.21
38 0.27
39 0.36
40 0.45
41 0.49
42 0.52
43 0.56
44 0.59
45 0.54
46 0.49
47 0.42
48 0.32
49 0.27
50 0.23
51 0.2
52 0.17
53 0.17
54 0.14
55 0.15
56 0.17
57 0.17
58 0.23
59 0.22
60 0.21
61 0.21
62 0.27
63 0.29
64 0.31
65 0.33
66 0.3
67 0.34
68 0.36
69 0.33
70 0.29
71 0.26
72 0.22
73 0.22
74 0.19
75 0.15
76 0.12
77 0.14
78 0.14
79 0.14
80 0.12
81 0.1
82 0.11
83 0.11
84 0.12
85 0.13
86 0.13
87 0.12
88 0.12
89 0.13
90 0.12
91 0.16
92 0.16
93 0.14
94 0.16
95 0.18
96 0.25
97 0.3
98 0.39
99 0.43
100 0.5
101 0.59
102 0.67
103 0.76
104 0.79
105 0.84
106 0.85
107 0.88
108 0.89
109 0.9
110 0.89
111 0.86
112 0.87
113 0.87
114 0.87
115 0.86
116 0.82
117 0.75
118 0.75
119 0.71
120 0.63
121 0.57
122 0.49
123 0.42
124 0.37
125 0.32
126 0.23
127 0.18