Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A5B0R1T7

Protein Details
Accession A0A5B0R1T7    Localization Confidence Low Confidence Score 8.7
NoLS Segment(s)
PositionSequenceProtein Nature
47-67KGPPAKRKNLPLNKPNKPKPIBasic
NLS Segment(s)
PositionSequence
44-73AIAKGPPAKRKNLPLNKPNKPKPITPPSHR
Subcellular Location(s) extr 19, nucl 2, mito 2, plas 2, mito_nucl 2
Family & Domain DBs
Amino Acid Sequences MRLLLIVAALIPFAYLQEPGRQVQRDGTGFVDRLGKRGSGDPIAIAKGPPAKRKNLPLNKPNKPKPITPPSHRPLKNNNRLLYSAADGYYTEMFN
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.05
2 0.06
3 0.07
4 0.12
5 0.15
6 0.16
7 0.23
8 0.23
9 0.24
10 0.26
11 0.31
12 0.27
13 0.26
14 0.27
15 0.24
16 0.22
17 0.23
18 0.27
19 0.21
20 0.22
21 0.22
22 0.2
23 0.18
24 0.21
25 0.22
26 0.16
27 0.16
28 0.14
29 0.14
30 0.14
31 0.13
32 0.1
33 0.09
34 0.13
35 0.16
36 0.23
37 0.25
38 0.29
39 0.33
40 0.42
41 0.51
42 0.55
43 0.61
44 0.62
45 0.7
46 0.75
47 0.81
48 0.8
49 0.79
50 0.72
51 0.69
52 0.7
53 0.71
54 0.7
55 0.67
56 0.7
57 0.66
58 0.73
59 0.71
60 0.67
61 0.67
62 0.7
63 0.73
64 0.71
65 0.69
66 0.63
67 0.62
68 0.58
69 0.5
70 0.42
71 0.33
72 0.25
73 0.22
74 0.17
75 0.19