Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A5B0PHQ6

Protein Details
Accession A0A5B0PHQ6   
Localization Confidence Low
Confidence Score 8
NoLS Segment(s)
PositionSequenceProtein Nature
65-88AAFLSISRRRRRRIQKVDNGFGTFHydrophilic
NLS Segment(s)
PositionSequence
74-75RR
Subcellular Location(s) E.R. 2, extr 10, mito 5, plas 7, vacu 2
Family & Domain DBs
Gene Ontology GO:0016020  C:membrane  
Amino Acid Sequences MLLGHSCASVSVALVTVTLESPRRVHGLKLGNTAPSGFATPPSNHIGAAVGGVLGSAAFIGLGLAAFLSISRRRRRRIQKVDNGFGTFMDAPSKASSSGMTLP
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.06
2 0.06
3 0.06
4 0.06
5 0.08
6 0.09
7 0.11
8 0.12
9 0.14
10 0.17
11 0.18
12 0.18
13 0.24
14 0.3
15 0.32
16 0.37
17 0.36
18 0.33
19 0.32
20 0.32
21 0.25
22 0.17
23 0.15
24 0.1
25 0.1
26 0.12
27 0.13
28 0.16
29 0.18
30 0.17
31 0.16
32 0.16
33 0.14
34 0.11
35 0.11
36 0.07
37 0.04
38 0.03
39 0.03
40 0.03
41 0.02
42 0.02
43 0.01
44 0.01
45 0.01
46 0.01
47 0.01
48 0.02
49 0.02
50 0.02
51 0.02
52 0.02
53 0.02
54 0.02
55 0.05
56 0.11
57 0.18
58 0.27
59 0.34
60 0.41
61 0.51
62 0.63
63 0.71
64 0.78
65 0.82
66 0.83
67 0.87
68 0.89
69 0.83
70 0.73
71 0.62
72 0.51
73 0.44
74 0.34
75 0.24
76 0.19
77 0.15
78 0.14
79 0.16
80 0.17
81 0.13
82 0.14
83 0.14