Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A5B0P3X2

Protein Details
Accession A0A5B0P3X2    Localization Confidence Low Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
56-80VTCSKPGTRCYCQRKPQSIKNSGQIHydrophilic
NLS Segment(s)
Subcellular Location(s) extr 12, mito 9, plas 2, E.R. 2
Family & Domain DBs
Amino Acid Sequences MRSILAAVLLSLAIFRDVSVTAAHCDLTLSKCTCKDGSMITTPALNIPGKKTHPVVTCSKPGTRCYCQRKPQSIKNSGQI
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.04
2 0.04
3 0.05
4 0.06
5 0.07
6 0.08
7 0.09
8 0.09
9 0.1
10 0.1
11 0.09
12 0.09
13 0.09
14 0.11
15 0.15
16 0.15
17 0.17
18 0.18
19 0.2
20 0.2
21 0.19
22 0.19
23 0.16
24 0.18
25 0.18
26 0.18
27 0.16
28 0.16
29 0.15
30 0.14
31 0.14
32 0.11
33 0.09
34 0.11
35 0.15
36 0.17
37 0.2
38 0.22
39 0.26
40 0.3
41 0.33
42 0.38
43 0.38
44 0.43
45 0.44
46 0.46
47 0.43
48 0.45
49 0.49
50 0.5
51 0.55
52 0.58
53 0.65
54 0.7
55 0.77
56 0.82
57 0.83
58 0.86
59 0.86
60 0.86