Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A5B0PKS7

Protein Details
Accession A0A5B0PKS7    Localization Confidence Medium Confidence Score 13
NoLS Segment(s)
PositionSequenceProtein Nature
39-58RSGPRRSGKIRKPRKPDQGSBasic
NLS Segment(s)
PositionSequence
40-55SGPRRSGKIRKPRKPD
Subcellular Location(s) nucl 19.5, cyto_nucl 14, cyto 5.5
Family & Domain DBs
Amino Acid Sequences MDGQANKENTPWSGCSGVRTSNHMKGFILLAGQPELGFRSGPRRSGKIRKPRKPDQGSGSTQRDPASGRMLKTPRSRGFAGITRIKPVRGPSCCTSALTFPP
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.23
2 0.26
3 0.26
4 0.3
5 0.28
6 0.33
7 0.36
8 0.39
9 0.41
10 0.38
11 0.35
12 0.31
13 0.3
14 0.23
15 0.18
16 0.12
17 0.1
18 0.1
19 0.1
20 0.08
21 0.08
22 0.08
23 0.08
24 0.07
25 0.06
26 0.14
27 0.16
28 0.22
29 0.24
30 0.28
31 0.34
32 0.44
33 0.53
34 0.56
35 0.65
36 0.68
37 0.74
38 0.79
39 0.83
40 0.79
41 0.76
42 0.72
43 0.69
44 0.65
45 0.63
46 0.59
47 0.49
48 0.45
49 0.39
50 0.33
51 0.27
52 0.24
53 0.25
54 0.23
55 0.22
56 0.29
57 0.31
58 0.37
59 0.42
60 0.5
61 0.47
62 0.5
63 0.5
64 0.45
65 0.48
66 0.47
67 0.47
68 0.46
69 0.43
70 0.44
71 0.44
72 0.42
73 0.4
74 0.41
75 0.43
76 0.39
77 0.45
78 0.42
79 0.46
80 0.47
81 0.46
82 0.41