Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A5B0NAH0

Protein Details
Accession A0A5B0NAH0    Localization Confidence Medium Confidence Score 13.6
NoLS Segment(s)
PositionSequenceProtein Nature
73-93AIFHYRIPRLPPRTRRPAPRPHydrophilic
NLS Segment(s)
PositionSequence
83-93PPRTRRPAPRP
Subcellular Location(s) nucl 14, mito 11
Family & Domain DBs
Amino Acid Sequences MTEVTNANARDRRKEFLVGALPHQLQLWLKPQDQLLVALQHHPQPRAQPAKLRPRQPQRKIATSEKASCFVWAIFHYRIPRLPPRTRRPAPRP
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.45
2 0.39
3 0.41
4 0.47
5 0.39
6 0.38
7 0.38
8 0.35
9 0.31
10 0.3
11 0.24
12 0.16
13 0.17
14 0.22
15 0.21
16 0.21
17 0.23
18 0.23
19 0.23
20 0.23
21 0.22
22 0.17
23 0.15
24 0.15
25 0.15
26 0.16
27 0.19
28 0.2
29 0.19
30 0.19
31 0.18
32 0.26
33 0.3
34 0.3
35 0.32
36 0.39
37 0.49
38 0.54
39 0.59
40 0.61
41 0.66
42 0.76
43 0.76
44 0.77
45 0.73
46 0.74
47 0.74
48 0.71
49 0.69
50 0.64
51 0.63
52 0.56
53 0.52
54 0.44
55 0.38
56 0.33
57 0.24
58 0.21
59 0.15
60 0.18
61 0.17
62 0.21
63 0.24
64 0.25
65 0.28
66 0.32
67 0.4
68 0.44
69 0.53
70 0.59
71 0.66
72 0.75
73 0.8