Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A5B0RC96

Protein Details
Accession A0A5B0RC96    Localization Confidence Low Confidence Score 9.1
NoLS Segment(s)
PositionSequenceProtein Nature
49-78THNSHEKRGLEKRKKKKGGGRGGGAKKKKABasic
NLS Segment(s)
PositionSequence
55-78KRGLEKRKKKKGGGRGGGAKKKKA
Subcellular Location(s) cyto 9, mito 8.5, cyto_nucl 7.833, mito_nucl 7.166, nucl 4.5, extr 3
Family & Domain DBs
Amino Acid Sequences MQLLQLSIFTLAAVLVASLHAEGVTSEIGSAEHKLVQAEESVGSTAPSTHNSHEKRGLEKRKKKKGGGRGGGAKKKKA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.04
2 0.03
3 0.03
4 0.03
5 0.03
6 0.03
7 0.03
8 0.03
9 0.03
10 0.04
11 0.04
12 0.04
13 0.04
14 0.04
15 0.05
16 0.06
17 0.06
18 0.06
19 0.07
20 0.07
21 0.07
22 0.07
23 0.07
24 0.07
25 0.07
26 0.06
27 0.06
28 0.06
29 0.05
30 0.05
31 0.05
32 0.05
33 0.06
34 0.09
35 0.11
36 0.13
37 0.22
38 0.24
39 0.29
40 0.35
41 0.37
42 0.41
43 0.5
44 0.59
45 0.61
46 0.69
47 0.76
48 0.8
49 0.86
50 0.88
51 0.87
52 0.87
53 0.87
54 0.86
55 0.84
56 0.83
57 0.84
58 0.85