Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A5B0P6V7

Protein Details
Accession A0A5B0P6V7    Localization Confidence Medium Confidence Score 11.3
NoLS Segment(s)
PositionSequenceProtein Nature
43-65RDGSKKSRPPCRRPGRKGDHMTHBasic
NLS Segment(s)
PositionSequence
54-56RRP
Subcellular Location(s) nucl 11.5, cyto_nucl 8.333, cysk 7, mito 4, cyto 4
Family & Domain DBs
Amino Acid Sequences MSSLSLKTIIHPDYVDNTLLENNLVKIKLTVISEPPLTDTTQRDGSKKSRPPCRRPGRKGDHMTHQGASGTRGCTGAPRPVRAALWVSMVALRRDRVDPQQARPGGD
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.25
2 0.23
3 0.17
4 0.17
5 0.16
6 0.16
7 0.14
8 0.11
9 0.1
10 0.12
11 0.12
12 0.11
13 0.1
14 0.11
15 0.14
16 0.14
17 0.15
18 0.14
19 0.17
20 0.17
21 0.17
22 0.18
23 0.16
24 0.15
25 0.16
26 0.16
27 0.17
28 0.24
29 0.25
30 0.24
31 0.27
32 0.32
33 0.38
34 0.43
35 0.47
36 0.5
37 0.58
38 0.65
39 0.72
40 0.78
41 0.8
42 0.8
43 0.83
44 0.81
45 0.82
46 0.82
47 0.75
48 0.72
49 0.67
50 0.62
51 0.52
52 0.44
53 0.35
54 0.28
55 0.26
56 0.19
57 0.14
58 0.13
59 0.13
60 0.12
61 0.14
62 0.16
63 0.22
64 0.24
65 0.26
66 0.27
67 0.29
68 0.3
69 0.29
70 0.29
71 0.22
72 0.21
73 0.18
74 0.17
75 0.17
76 0.19
77 0.19
78 0.19
79 0.19
80 0.19
81 0.22
82 0.26
83 0.3
84 0.39
85 0.42
86 0.46
87 0.55