Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A5B0P2W8

Protein Details
Accession A0A5B0P2W8   
Localization Confidence Medium
Confidence Score 11.3
NoLS Segment(s)
PositionSequenceProtein Nature
12-31AADLKKRRTFRKFQYRGIELHydrophilic
NLS Segment(s)
PositionSequence
49-79RARRRFQRGLKRKPMTLIKKLRKARKEAPPN
Subcellular Location(s) cyto 10, cyto_nucl 10, nucl 10
Family & Domain DBs
InterPro View protein in InterPro  
IPR002222  Ribosomal_S19  
IPR023575  Ribosomal_S19_S15_SF  
Gene Ontology GO:0016020  C:membrane  
GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF00203  Ribosomal_S19  
Amino Acid Sequences MSGVEFTDPQEAADLKKRRTFRKFQYRGIELEALLDLSNEQLMEVVHARARRRFQRGLKRKPMTLIKKLRKARKEAPPNEKPAVVKTHLRDMLVVPEMIGSVIGVGLFSLIFFQNVK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.31
2 0.32
3 0.39
4 0.45
5 0.52
6 0.6
7 0.66
8 0.68
9 0.73
10 0.76
11 0.78
12 0.81
13 0.75
14 0.68
15 0.63
16 0.54
17 0.42
18 0.35
19 0.26
20 0.17
21 0.14
22 0.11
23 0.06
24 0.05
25 0.05
26 0.04
27 0.04
28 0.04
29 0.04
30 0.05
31 0.06
32 0.06
33 0.08
34 0.11
35 0.13
36 0.17
37 0.23
38 0.29
39 0.34
40 0.41
41 0.48
42 0.57
43 0.66
44 0.72
45 0.77
46 0.73
47 0.68
48 0.66
49 0.67
50 0.63
51 0.62
52 0.62
53 0.6
54 0.66
55 0.73
56 0.75
57 0.72
58 0.72
59 0.71
60 0.71
61 0.74
62 0.74
63 0.76
64 0.75
65 0.75
66 0.7
67 0.63
68 0.54
69 0.46
70 0.43
71 0.36
72 0.35
73 0.31
74 0.38
75 0.37
76 0.36
77 0.34
78 0.29
79 0.31
80 0.27
81 0.24
82 0.15
83 0.13
84 0.13
85 0.12
86 0.1
87 0.05
88 0.03
89 0.03
90 0.03
91 0.03
92 0.03
93 0.03
94 0.03
95 0.03
96 0.05
97 0.05