Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A5B0Q597

Protein Details
Accession A0A5B0Q597    Localization Confidence Medium Confidence Score 11.4
NoLS Segment(s)
PositionSequenceProtein Nature
56-75SPLTKSPENKPPKKSSKSPAHydrophilic
NLS Segment(s)
PositionSequence
64-73NKPPKKSSKS
Subcellular Location(s) nucl 11.5, mito 9, cyto_nucl 8.5, cyto 4.5
Family & Domain DBs
Amino Acid Sequences MSFDIPNGFFCASQLLQTCHNSLTTPALKAKEAVSPITGNPEEPATLPVKPKAAVSPLTKSPENKPPKKSSKSPA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.19
2 0.18
3 0.22
4 0.24
5 0.25
6 0.21
7 0.21
8 0.18
9 0.16
10 0.21
11 0.18
12 0.19
13 0.21
14 0.22
15 0.21
16 0.22
17 0.22
18 0.18
19 0.18
20 0.16
21 0.14
22 0.13
23 0.13
24 0.17
25 0.16
26 0.13
27 0.12
28 0.12
29 0.1
30 0.1
31 0.12
32 0.09
33 0.11
34 0.13
35 0.14
36 0.16
37 0.16
38 0.16
39 0.17
40 0.19
41 0.23
42 0.25
43 0.29
44 0.33
45 0.37
46 0.39
47 0.4
48 0.42
49 0.47
50 0.53
51 0.56
52 0.59
53 0.64
54 0.72
55 0.78