Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A5B0Q0Q2

Protein Details
Accession A0A5B0Q0Q2    Localization Confidence Medium Confidence Score 10.4
NoLS Segment(s)
PositionSequenceProtein Nature
1-28MPPKSKQSSRQTKSKPKAQARQRTPSPLHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 20.5, cyto_nucl 13, cyto 4.5
Family & Domain DBs
Amino Acid Sequences MPPKSKQSSRQTKSKPKAQARQRTPSPLNESHESSGDDQEMEDQSSDEEAPRLDMKSLLKALENQSKQKLAKKQNKTFQEIESVLQGVLVDRLNNLVKTQESEL
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.84
2 0.83
3 0.82
4 0.86
5 0.86
6 0.86
7 0.83
8 0.84
9 0.81
10 0.8
11 0.73
12 0.71
13 0.68
14 0.63
15 0.6
16 0.54
17 0.52
18 0.44
19 0.42
20 0.36
21 0.3
22 0.25
23 0.19
24 0.16
25 0.12
26 0.12
27 0.11
28 0.1
29 0.08
30 0.07
31 0.07
32 0.07
33 0.07
34 0.06
35 0.05
36 0.05
37 0.06
38 0.07
39 0.07
40 0.07
41 0.09
42 0.09
43 0.12
44 0.13
45 0.12
46 0.12
47 0.15
48 0.2
49 0.26
50 0.28
51 0.28
52 0.3
53 0.35
54 0.37
55 0.41
56 0.45
57 0.48
58 0.55
59 0.63
60 0.69
61 0.73
62 0.77
63 0.77
64 0.71
65 0.62
66 0.59
67 0.5
68 0.41
69 0.34
70 0.28
71 0.21
72 0.18
73 0.16
74 0.09
75 0.1
76 0.09
77 0.08
78 0.07
79 0.11
80 0.14
81 0.15
82 0.15
83 0.16
84 0.17