Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A5B0S7Y1

Protein Details
Accession A0A5B0S7Y1   
Localization Confidence Medium
Confidence Score 14.4
NoLS Segment(s)
PositionSequenceProtein Nature
72-99EPINQLKKSNNFKRKRIMKKRTTTVKEEHydrophilic
NLS Segment(s)
PositionSequence
83-92FKRKRIMKKR
Subcellular Location(s) cyto_nucl 13.5, nucl 23.5
Family & Domain DBs
Amino Acid Sequences MTGHNRPSSGGVLHQMTSHNRPSSGGVLHQMTGQDRPSSGGVLHRMTGQYRPPSGMCTPPDDDDRTNQNQPEPINQLKKSNNFKRKRIMKKRTTTVKEE
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.23
2 0.23
3 0.25
4 0.28
5 0.32
6 0.29
7 0.28
8 0.28
9 0.3
10 0.3
11 0.27
12 0.24
13 0.23
14 0.22
15 0.22
16 0.22
17 0.2
18 0.18
19 0.18
20 0.17
21 0.12
22 0.11
23 0.13
24 0.13
25 0.12
26 0.11
27 0.13
28 0.14
29 0.14
30 0.15
31 0.14
32 0.14
33 0.14
34 0.16
35 0.17
36 0.17
37 0.17
38 0.18
39 0.17
40 0.2
41 0.21
42 0.24
43 0.21
44 0.22
45 0.24
46 0.24
47 0.27
48 0.26
49 0.26
50 0.25
51 0.29
52 0.3
53 0.32
54 0.31
55 0.3
56 0.3
57 0.3
58 0.32
59 0.32
60 0.34
61 0.38
62 0.39
63 0.44
64 0.47
65 0.55
66 0.61
67 0.65
68 0.69
69 0.7
70 0.75
71 0.79
72 0.83
73 0.86
74 0.86
75 0.86
76 0.87
77 0.89
78 0.92
79 0.93