Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A5B0LJV3

Protein Details
Accession A0A5B0LJV3    Localization Confidence Medium Confidence Score 13.7
NoLS Segment(s)
PositionSequenceProtein Nature
418-475TTSSRGSKPAPAKKKQTSSRKPVTSRKQPSSKPTGKSRSAKPKPTKRTQRPIPEEDEDHydrophilic
NLS Segment(s)
PositionSequence
422-465RGSKPAPAKKKQTSSRKPVTSRKQPSSKPTGKSRSAKPKPTKRT
Subcellular Location(s) nucl 21.5, cyto_nucl 11.5, mito 5
Family & Domain DBs
InterPro View protein in InterPro  
IPR000305  GIY-YIG_endonuc  
IPR035901  GIY-YIG_endonuc_sf  
IPR027520  Slx1  
IPR013083  Znf_RING/FYVE/PHD  
Gene Ontology GO:0033557  C:Slx1-Slx4 complex  
GO:0017108  F:5'-flap endonuclease activity  
GO:0006310  P:DNA recombination  
GO:0006281  P:DNA repair  
Pfam View protein in Pfam  
PF01541  GIY-YIG  
PROSITE View protein in PROSITE  
PS50164  GIY_YIG  
CDD cd10455  GIY-YIG_SLX1  
Amino Acid Sequences MSSTQPNSSGTKKRTTTSTLHPGLHQYPAFYACYLLRSYYKGKRNERTYVGSTPNPPRRIRQHNGELKGGAVRTKYYRPWEMELICYGFPSKLVALQFEWAWNTPYKSRHLQAVKPTKEDSKQTELDSTGAIAGKAPTATQTKKPMFPRSTGNRVEVKLKVLRKMMTTLPWSQYPLKVLFFDESAYRLWLEQAKPPKSVSKQTSTTSDTLGVSVHPIEVTFRPEGVDGMRKDRHTIPSSPDDQRKPIEVHDEEAVLEDYEKIELIKKRCNGDLKCFLCDQSIDVEDHLSYVNCRSPDCFMSAHLLCLSKHLLDASTIDPLPPLTIGDEPQPSLPRVLPDRGRCPACSVDFRWGELVKGCYRRMPKNHTKAQISDADDEEEADLVFPYAEGDNQYPNLNDYGNTSVTEDEVDPNIRGSTTSSRGSKPAPAKKKQTSSRKPVTSRKQPSSKPTGKSRSAKPKPTKRTQRPIPEEDEDEPEQDFVKLMEELQVSD
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.55
2 0.57
3 0.55
4 0.55
5 0.61
6 0.58
7 0.56
8 0.54
9 0.55
10 0.51
11 0.52
12 0.43
13 0.33
14 0.29
15 0.3
16 0.3
17 0.23
18 0.23
19 0.17
20 0.19
21 0.19
22 0.19
23 0.19
24 0.22
25 0.3
26 0.37
27 0.44
28 0.51
29 0.6
30 0.67
31 0.72
32 0.76
33 0.75
34 0.73
35 0.71
36 0.68
37 0.65
38 0.6
39 0.6
40 0.62
41 0.64
42 0.63
43 0.6
44 0.62
45 0.65
46 0.7
47 0.71
48 0.7
49 0.72
50 0.75
51 0.76
52 0.72
53 0.62
54 0.53
55 0.49
56 0.4
57 0.32
58 0.23
59 0.22
60 0.23
61 0.28
62 0.33
63 0.37
64 0.43
65 0.45
66 0.49
67 0.53
68 0.5
69 0.47
70 0.44
71 0.4
72 0.32
73 0.28
74 0.24
75 0.17
76 0.15
77 0.14
78 0.11
79 0.12
80 0.13
81 0.15
82 0.15
83 0.16
84 0.17
85 0.16
86 0.18
87 0.15
88 0.17
89 0.17
90 0.19
91 0.22
92 0.26
93 0.3
94 0.34
95 0.35
96 0.42
97 0.46
98 0.48
99 0.54
100 0.61
101 0.6
102 0.57
103 0.58
104 0.54
105 0.53
106 0.53
107 0.49
108 0.46
109 0.45
110 0.43
111 0.43
112 0.38
113 0.34
114 0.28
115 0.22
116 0.16
117 0.13
118 0.11
119 0.09
120 0.08
121 0.08
122 0.08
123 0.08
124 0.1
125 0.15
126 0.18
127 0.23
128 0.32
129 0.35
130 0.42
131 0.49
132 0.55
133 0.52
134 0.52
135 0.56
136 0.55
137 0.6
138 0.56
139 0.55
140 0.5
141 0.48
142 0.5
143 0.41
144 0.38
145 0.36
146 0.36
147 0.36
148 0.35
149 0.35
150 0.32
151 0.34
152 0.32
153 0.3
154 0.31
155 0.3
156 0.29
157 0.29
158 0.31
159 0.29
160 0.28
161 0.26
162 0.25
163 0.22
164 0.2
165 0.2
166 0.17
167 0.16
168 0.15
169 0.12
170 0.11
171 0.1
172 0.1
173 0.09
174 0.08
175 0.1
176 0.13
177 0.14
178 0.18
179 0.27
180 0.29
181 0.3
182 0.32
183 0.37
184 0.36
185 0.43
186 0.43
187 0.41
188 0.43
189 0.43
190 0.47
191 0.44
192 0.41
193 0.33
194 0.3
195 0.23
196 0.19
197 0.17
198 0.12
199 0.09
200 0.08
201 0.07
202 0.05
203 0.05
204 0.06
205 0.07
206 0.1
207 0.1
208 0.1
209 0.1
210 0.1
211 0.11
212 0.11
213 0.16
214 0.14
215 0.19
216 0.23
217 0.22
218 0.25
219 0.28
220 0.33
221 0.3
222 0.32
223 0.31
224 0.34
225 0.39
226 0.41
227 0.43
228 0.39
229 0.38
230 0.36
231 0.35
232 0.3
233 0.26
234 0.29
235 0.23
236 0.23
237 0.21
238 0.2
239 0.17
240 0.16
241 0.15
242 0.08
243 0.07
244 0.06
245 0.05
246 0.05
247 0.05
248 0.04
249 0.08
250 0.13
251 0.16
252 0.22
253 0.26
254 0.28
255 0.32
256 0.4
257 0.38
258 0.42
259 0.49
260 0.45
261 0.43
262 0.41
263 0.38
264 0.3
265 0.28
266 0.21
267 0.13
268 0.13
269 0.11
270 0.1
271 0.1
272 0.09
273 0.1
274 0.09
275 0.06
276 0.06
277 0.07
278 0.1
279 0.1
280 0.1
281 0.11
282 0.13
283 0.15
284 0.17
285 0.15
286 0.14
287 0.19
288 0.19
289 0.19
290 0.17
291 0.18
292 0.15
293 0.17
294 0.17
295 0.11
296 0.11
297 0.11
298 0.1
299 0.09
300 0.11
301 0.09
302 0.11
303 0.11
304 0.11
305 0.1
306 0.1
307 0.1
308 0.08
309 0.07
310 0.06
311 0.07
312 0.08
313 0.11
314 0.12
315 0.12
316 0.15
317 0.16
318 0.16
319 0.16
320 0.16
321 0.17
322 0.2
323 0.25
324 0.3
325 0.34
326 0.39
327 0.44
328 0.45
329 0.42
330 0.42
331 0.41
332 0.39
333 0.38
334 0.34
335 0.37
336 0.35
337 0.35
338 0.35
339 0.3
340 0.27
341 0.24
342 0.26
343 0.23
344 0.27
345 0.27
346 0.3
347 0.36
348 0.43
349 0.49
350 0.55
351 0.6
352 0.66
353 0.74
354 0.76
355 0.74
356 0.68
357 0.64
358 0.61
359 0.54
360 0.47
361 0.39
362 0.33
363 0.28
364 0.26
365 0.21
366 0.14
367 0.11
368 0.08
369 0.07
370 0.05
371 0.05
372 0.04
373 0.05
374 0.05
375 0.06
376 0.08
377 0.09
378 0.11
379 0.13
380 0.14
381 0.13
382 0.15
383 0.15
384 0.14
385 0.13
386 0.14
387 0.16
388 0.16
389 0.16
390 0.16
391 0.15
392 0.15
393 0.16
394 0.13
395 0.12
396 0.13
397 0.14
398 0.14
399 0.14
400 0.15
401 0.13
402 0.13
403 0.15
404 0.19
405 0.22
406 0.28
407 0.31
408 0.33
409 0.36
410 0.38
411 0.43
412 0.46
413 0.52
414 0.56
415 0.61
416 0.69
417 0.75
418 0.83
419 0.85
420 0.86
421 0.86
422 0.87
423 0.88
424 0.88
425 0.87
426 0.87
427 0.88
428 0.88
429 0.88
430 0.87
431 0.87
432 0.84
433 0.84
434 0.85
435 0.82
436 0.79
437 0.79
438 0.78
439 0.78
440 0.79
441 0.81
442 0.81
443 0.83
444 0.86
445 0.86
446 0.88
447 0.89
448 0.92
449 0.93
450 0.92
451 0.93
452 0.93
453 0.93
454 0.92
455 0.88
456 0.85
457 0.79
458 0.73
459 0.65
460 0.61
461 0.52
462 0.44
463 0.37
464 0.29
465 0.24
466 0.19
467 0.17
468 0.1
469 0.11
470 0.1
471 0.1
472 0.15