Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A5B0LXY7

Protein Details
Accession A0A5B0LXY7   
Localization Confidence Low
Confidence Score 8.1
NoLS Segment(s)
PositionSequenceProtein Nature
2-27SYNLPCISKSPKKKMKRFVDDSERSFHydrophilic
NLS Segment(s)
Subcellular Location(s) cyto 6, cyto_nucl 11.833, mito 5.5, mito_nucl 11.166, nucl 15.5
Family & Domain DBs
Amino Acid Sequences MSYNLPCISKSPKKKMKRFVDDSERSFGLPSQLMNLKKRLPWRAYSMDKSHIRDQASDDRILQRAQMATQLGASLIHGRTSLLGLHRGHTGLFFGLLRPFHTWPS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.8
2 0.87
3 0.88
4 0.89
5 0.87
6 0.85
7 0.86
8 0.83
9 0.77
10 0.71
11 0.61
12 0.5
13 0.43
14 0.33
15 0.25
16 0.18
17 0.15
18 0.14
19 0.19
20 0.22
21 0.24
22 0.27
23 0.27
24 0.29
25 0.36
26 0.4
27 0.37
28 0.38
29 0.42
30 0.46
31 0.49
32 0.51
33 0.48
34 0.48
35 0.49
36 0.49
37 0.47
38 0.43
39 0.38
40 0.33
41 0.35
42 0.35
43 0.33
44 0.3
45 0.27
46 0.25
47 0.25
48 0.24
49 0.2
50 0.14
51 0.12
52 0.11
53 0.13
54 0.11
55 0.1
56 0.1
57 0.1
58 0.08
59 0.07
60 0.08
61 0.08
62 0.08
63 0.08
64 0.08
65 0.08
66 0.09
67 0.1
68 0.12
69 0.1
70 0.16
71 0.16
72 0.18
73 0.19
74 0.19
75 0.18
76 0.17
77 0.16
78 0.1
79 0.12
80 0.1
81 0.1
82 0.14
83 0.14
84 0.16
85 0.2