Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A5B0PEP6

Protein Details
Accession A0A5B0PEP6    Localization Confidence Medium Confidence Score 13.3
NoLS Segment(s)
PositionSequenceProtein Nature
17-49KKPSLFPQKALKKKCKQKYKYFKKQENNSKAAKHydrophilic
NLS Segment(s)
PositionSequence
24-34QKALKKKCKQK
Subcellular Location(s) nucl 21.5, cyto_nucl 14.5, cyto 4.5
Family & Domain DBs
Amino Acid Sequences MAAHQILKPHSKNPDEKKPSLFPQKALKKKCKQKYKYFKKQENNSKAAKVFTRNIHPDTKTMRRAYKKLDLHLADGTQKLTPAEVQADEDMVLNFTLINHR
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.67
2 0.67
3 0.69
4 0.7
5 0.68
6 0.69
7 0.7
8 0.64
9 0.57
10 0.6
11 0.66
12 0.68
13 0.7
14 0.72
15 0.71
16 0.79
17 0.84
18 0.85
19 0.83
20 0.86
21 0.88
22 0.89
23 0.91
24 0.91
25 0.91
26 0.9
27 0.91
28 0.9
29 0.88
30 0.81
31 0.73
32 0.65
33 0.56
34 0.48
35 0.4
36 0.33
37 0.29
38 0.27
39 0.31
40 0.31
41 0.33
42 0.36
43 0.35
44 0.34
45 0.37
46 0.41
47 0.41
48 0.42
49 0.47
50 0.48
51 0.51
52 0.54
53 0.57
54 0.55
55 0.52
56 0.56
57 0.49
58 0.46
59 0.44
60 0.38
61 0.31
62 0.27
63 0.24
64 0.16
65 0.15
66 0.13
67 0.11
68 0.11
69 0.1
70 0.12
71 0.12
72 0.14
73 0.13
74 0.14
75 0.13
76 0.14
77 0.12
78 0.1
79 0.09
80 0.07
81 0.07