Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A5B0Q0C8

Protein Details
Accession A0A5B0Q0C8    Localization Confidence Medium Confidence Score 14.2
NoLS Segment(s)
PositionSequenceProtein Nature
52-73TTRDSPASDPRPKKRGRRERTPBasic
NLS Segment(s)
PositionSequence
61-73PRPKKRGRRERTP
Subcellular Location(s) nucl 24, cyto_nucl 14.5
Family & Domain DBs
Amino Acid Sequences MNASNPAANGVGQGELDDNIEDLLADDISVSEAPSEESGADEPTGADCNINTTRDSPASDPRPKKRGRRERTP
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.07
2 0.07
3 0.08
4 0.07
5 0.06
6 0.06
7 0.06
8 0.05
9 0.05
10 0.05
11 0.04
12 0.04
13 0.04
14 0.04
15 0.05
16 0.05
17 0.04
18 0.04
19 0.04
20 0.04
21 0.05
22 0.05
23 0.04
24 0.05
25 0.05
26 0.06
27 0.06
28 0.05
29 0.05
30 0.05
31 0.07
32 0.06
33 0.06
34 0.05
35 0.1
36 0.13
37 0.14
38 0.14
39 0.14
40 0.17
41 0.19
42 0.22
43 0.2
44 0.27
45 0.35
46 0.44
47 0.52
48 0.57
49 0.65
50 0.71
51 0.79
52 0.81
53 0.83