Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A5B0MSM9

Protein Details
Accession A0A5B0MSM9   
Localization Confidence Medium
Confidence Score 14.7
NoLS Segment(s)
PositionSequenceProtein Nature
14-42VSSPLVTPSRRRNRRVKFGARQCRPKTSTHydrophilic
NLS Segment(s)
PositionSequence
23-30RRRNRRVK
115-118KRRR
125-132GPPKKRRK
Subcellular Location(s) cyto_nucl 5, mito 18, nucl 8.5
Family & Domain DBs
Amino Acid Sequences MAGPPPRAKHAPPVSSPLVTPSRRRNRRVKFGARQCRPKTSTKVRLAYAPSFPIITASASHSYRLIARGPLSPIIRLNPTQKSLREDVLNRVYPVAIPRPTPTPTPTPLRPTPLKRRRADDDDQGPPKKRRK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.52
2 0.48
3 0.46
4 0.42
5 0.4
6 0.37
7 0.41
8 0.45
9 0.52
10 0.6
11 0.67
12 0.72
13 0.74
14 0.82
15 0.86
16 0.85
17 0.85
18 0.87
19 0.91
20 0.89
21 0.89
22 0.83
23 0.82
24 0.75
25 0.72
26 0.7
27 0.7
28 0.71
29 0.69
30 0.7
31 0.61
32 0.62
33 0.59
34 0.52
35 0.44
36 0.35
37 0.26
38 0.22
39 0.2
40 0.16
41 0.12
42 0.1
43 0.08
44 0.1
45 0.13
46 0.13
47 0.14
48 0.13
49 0.13
50 0.13
51 0.14
52 0.12
53 0.1
54 0.11
55 0.12
56 0.13
57 0.17
58 0.17
59 0.16
60 0.16
61 0.16
62 0.17
63 0.18
64 0.21
65 0.2
66 0.23
67 0.26
68 0.28
69 0.31
70 0.31
71 0.31
72 0.32
73 0.3
74 0.34
75 0.37
76 0.37
77 0.32
78 0.3
79 0.28
80 0.24
81 0.25
82 0.24
83 0.19
84 0.18
85 0.2
86 0.24
87 0.26
88 0.28
89 0.29
90 0.28
91 0.31
92 0.38
93 0.4
94 0.44
95 0.46
96 0.51
97 0.55
98 0.59
99 0.65
100 0.67
101 0.73
102 0.71
103 0.75
104 0.76
105 0.75
106 0.73
107 0.71
108 0.7
109 0.7
110 0.72
111 0.72
112 0.71