Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

H1W4U4

Protein Details
Accession H1W4U4    Localization Confidence Medium Confidence Score 10.4
NoLS Segment(s)
PositionSequenceProtein Nature
26-52VEGKATYKSWKKKYRKMRITFDRKMHDHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 20, cyto_nucl 13, cyto 4
Family & Domain DBs
InterPro View protein in InterPro  
IPR032742  Iec3  
Gene Ontology GO:0031011  C:Ino80 complex  
GO:0006338  P:chromatin remodeling  
Pfam View protein in Pfam  
PF14612  Ino80_Iec3  
Amino Acid Sequences MSDANGTITSREVKAEGYDTDDARTVEGKATYKSWKKKYRKMRITFDRKMHDCENLHRQESHALATAKRIAIENE
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.15
2 0.17
3 0.15
4 0.17
5 0.19
6 0.19
7 0.19
8 0.2
9 0.18
10 0.16
11 0.17
12 0.12
13 0.12
14 0.13
15 0.14
16 0.13
17 0.16
18 0.23
19 0.29
20 0.37
21 0.45
22 0.53
23 0.6
24 0.68
25 0.76
26 0.8
27 0.83
28 0.83
29 0.84
30 0.85
31 0.86
32 0.85
33 0.81
34 0.78
35 0.7
36 0.67
37 0.58
38 0.54
39 0.47
40 0.46
41 0.48
42 0.45
43 0.45
44 0.4
45 0.39
46 0.37
47 0.36
48 0.32
49 0.28
50 0.25
51 0.23
52 0.27
53 0.29
54 0.26
55 0.25