Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A5B0LN10

Protein Details
Accession A0A5B0LN10    Localization Confidence Medium Confidence Score 14.9
NoLS Segment(s)
PositionSequenceProtein Nature
74-102LLSGSRRPSRPLPRVPRKRLLNRNLKLLLHydrophilic
NLS Segment(s)
PositionSequence
78-92SRRPSRPLPRVPRKR
Subcellular Location(s) nucl 18, cyto 4, extr 4
Family & Domain DBs
Amino Acid Sequences MGASFGASASAPSTAPITAGAAGDPAVALAAHALERAGTRLGVLLPSSPSHALRLRPPKLALPSRPTLLPSLRLLSGSRRPSRPLPRVPRKRLLNRNLKLLLPLAI
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.08
2 0.08
3 0.08
4 0.09
5 0.09
6 0.09
7 0.08
8 0.07
9 0.07
10 0.06
11 0.06
12 0.04
13 0.03
14 0.03
15 0.03
16 0.03
17 0.03
18 0.03
19 0.03
20 0.03
21 0.04
22 0.04
23 0.05
24 0.06
25 0.05
26 0.05
27 0.06
28 0.06
29 0.06
30 0.06
31 0.06
32 0.07
33 0.07
34 0.09
35 0.09
36 0.09
37 0.12
38 0.14
39 0.15
40 0.22
41 0.31
42 0.32
43 0.34
44 0.34
45 0.35
46 0.4
47 0.44
48 0.41
49 0.38
50 0.38
51 0.36
52 0.36
53 0.33
54 0.29
55 0.25
56 0.24
57 0.2
58 0.2
59 0.18
60 0.19
61 0.19
62 0.22
63 0.28
64 0.33
65 0.38
66 0.38
67 0.42
68 0.5
69 0.6
70 0.63
71 0.65
72 0.68
73 0.74
74 0.82
75 0.86
76 0.87
77 0.87
78 0.88
79 0.88
80 0.88
81 0.87
82 0.81
83 0.82
84 0.75
85 0.65
86 0.57