Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A5B0LN20

Protein Details
Accession A0A5B0LN20   
Localization Confidence Low
Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
110-129SLKRLFPKKDPPKVSSKPKTHydrophilic
NLS Segment(s)
Subcellular Location(s) E.R. 3, cyto_mito 2, extr 7, golg 2, mito 4, mito_nucl 2, pero 2, plas 9
Family & Domain DBs
Amino Acid Sequences MASLMCFTWLILGAVLVEGMEIISSGSSATRTTFGGSRIAKEAGPEELASSLAQKANPVSLKNPIEEGGSLGRGERSKTLKPLPTPSGFTRWTGRAKESFYKMMDRITESLKRLFPKKDPPKVSSKPKTL
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.07
2 0.07
3 0.05
4 0.04
5 0.03
6 0.03
7 0.03
8 0.02
9 0.02
10 0.02
11 0.03
12 0.03
13 0.03
14 0.04
15 0.05
16 0.06
17 0.07
18 0.08
19 0.1
20 0.12
21 0.13
22 0.2
23 0.2
24 0.21
25 0.23
26 0.23
27 0.21
28 0.2
29 0.2
30 0.14
31 0.14
32 0.12
33 0.1
34 0.09
35 0.1
36 0.09
37 0.08
38 0.08
39 0.08
40 0.08
41 0.08
42 0.08
43 0.11
44 0.13
45 0.13
46 0.13
47 0.19
48 0.2
49 0.2
50 0.21
51 0.18
52 0.16
53 0.15
54 0.15
55 0.09
56 0.08
57 0.08
58 0.07
59 0.09
60 0.09
61 0.1
62 0.13
63 0.17
64 0.19
65 0.24
66 0.29
67 0.33
68 0.35
69 0.41
70 0.42
71 0.4
72 0.43
73 0.41
74 0.41
75 0.37
76 0.36
77 0.34
78 0.33
79 0.36
80 0.34
81 0.35
82 0.34
83 0.38
84 0.42
85 0.43
86 0.43
87 0.4
88 0.42
89 0.39
90 0.38
91 0.35
92 0.31
93 0.28
94 0.29
95 0.32
96 0.3
97 0.34
98 0.35
99 0.39
100 0.41
101 0.45
102 0.46
103 0.52
104 0.6
105 0.66
106 0.69
107 0.69
108 0.73
109 0.77
110 0.81