Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A5B0RBS9

Protein Details
Accession A0A5B0RBS9   
Localization Confidence Medium
Confidence Score 14.4
NoLS Segment(s)
PositionSequenceProtein Nature
2-54TTSHVSKAAKGQQRRHRREKSKKDAPVPKAAMKKTKKTKPRKKLNPPGTRLVPHydrophilic
NLS Segment(s)
PositionSequence
9-46AAKGQQRRHRREKSKKDAPVPKAAMKKTKKTKPRKKLN
Subcellular Location(s) cyto_nucl 13, nucl 23.5
Family & Domain DBs
Amino Acid Sequences MTTSHVSKAAKGQQRRHRREKSKKDAPVPKAAMKKTKKTKPRKKLNPPGTRLVPIQINSNADDDELQLLNTRPVIDIPKSVQTSTTDHEHEEFQEEEIEARNQANDLVQYFNLAIDDETSDDESGDDDPLEELWPISTVGQLR
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.74
2 0.81
3 0.84
4 0.86
5 0.88
6 0.91
7 0.93
8 0.93
9 0.92
10 0.91
11 0.91
12 0.9
13 0.84
14 0.83
15 0.77
16 0.73
17 0.7
18 0.65
19 0.65
20 0.62
21 0.66
22 0.66
23 0.7
24 0.74
25 0.77
26 0.84
27 0.85
28 0.9
29 0.91
30 0.92
31 0.94
32 0.95
33 0.93
34 0.87
35 0.84
36 0.76
37 0.67
38 0.56
39 0.48
40 0.4
41 0.3
42 0.29
43 0.24
44 0.22
45 0.2
46 0.2
47 0.17
48 0.14
49 0.14
50 0.1
51 0.09
52 0.08
53 0.06
54 0.07
55 0.07
56 0.07
57 0.07
58 0.07
59 0.06
60 0.07
61 0.09
62 0.09
63 0.1
64 0.12
65 0.17
66 0.18
67 0.18
68 0.19
69 0.19
70 0.21
71 0.21
72 0.23
73 0.18
74 0.18
75 0.19
76 0.19
77 0.17
78 0.17
79 0.15
80 0.12
81 0.12
82 0.11
83 0.11
84 0.12
85 0.12
86 0.09
87 0.09
88 0.09
89 0.08
90 0.08
91 0.09
92 0.08
93 0.09
94 0.1
95 0.1
96 0.11
97 0.1
98 0.1
99 0.1
100 0.09
101 0.08
102 0.06
103 0.07
104 0.07
105 0.09
106 0.1
107 0.1
108 0.09
109 0.09
110 0.09
111 0.09
112 0.09
113 0.08
114 0.07
115 0.07
116 0.07
117 0.08
118 0.08
119 0.07
120 0.07
121 0.08
122 0.08
123 0.08