Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A5B0LTS3

Protein Details
Accession A0A5B0LTS3   
Localization Confidence Low
Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
84-105VFYGREKCPKQHHQPVPHFFNCHydrophilic
NLS Segment(s)
Subcellular Location(s) E.R. 9, cyto 2, cyto_mito 2, cyto_pero 3, extr 5, golg 2, mito 2, pero 4, plas 3
Family & Domain DBs
Amino Acid Sequences MFTQLGIVYCQVMCFVLAGDLVKPPFCYNCYKLDGFRSKPQVPTLEIQMNYVYGTTTCRVLSKHACQEPVEADLYVCKVCDHYVFYGREKCPKQHHQPVPHFFNCSETTWPPPFIRNTR
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.07
2 0.07
3 0.06
4 0.06
5 0.07
6 0.07
7 0.1
8 0.1
9 0.11
10 0.11
11 0.12
12 0.14
13 0.16
14 0.22
15 0.22
16 0.27
17 0.32
18 0.33
19 0.34
20 0.4
21 0.46
22 0.44
23 0.49
24 0.51
25 0.48
26 0.49
27 0.5
28 0.44
29 0.39
30 0.36
31 0.34
32 0.31
33 0.28
34 0.26
35 0.23
36 0.2
37 0.17
38 0.15
39 0.1
40 0.05
41 0.07
42 0.06
43 0.07
44 0.07
45 0.08
46 0.09
47 0.13
48 0.18
49 0.22
50 0.29
51 0.31
52 0.32
53 0.32
54 0.33
55 0.3
56 0.27
57 0.22
58 0.14
59 0.11
60 0.1
61 0.11
62 0.09
63 0.08
64 0.06
65 0.06
66 0.07
67 0.09
68 0.11
69 0.13
70 0.2
71 0.22
72 0.27
73 0.34
74 0.35
75 0.42
76 0.43
77 0.47
78 0.49
79 0.57
80 0.63
81 0.66
82 0.74
83 0.75
84 0.82
85 0.85
86 0.84
87 0.76
88 0.7
89 0.59
90 0.55
91 0.47
92 0.4
93 0.36
94 0.31
95 0.35
96 0.35
97 0.39
98 0.35
99 0.38